Basic Vector Information
- Vector Name:
- pGal4-p65f286-518
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5209 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- RSV
pGal4-p65f286-518 vector Map
pGal4-p65f286-518 vector Sequence
LOCUS 40924_21000 5209 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pGal4-p65f286-518, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5209) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5209) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5209) TITLE Direct Submission REFERENCE 4 (bases 1 to 5209) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5209 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(766..900) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(928..1635) /codon_start=1 /note="unnamed protein product; p65f" /protein_id="SJL87653.1" /translation="EFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPR RIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLP QAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDD EDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTG AQRPPDPAPAPLGA" CDS complement(1639..2079) /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" promoter complement(2221..2482) /label=RSV promoter /note="Rous sarcoma virus enhancer/promoter" promoter 2807..3136 /label=SV40 promoter /note="SV40 enhancer and early promoter" rep_origin complement(3382..3970) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4144..5001) /label=AmpR /note="beta-lactamase" promoter complement(5002..5106) /label=AmpR promoter
This page is informational only.