Basic Vector Information
- Vector Name:
- pGal4-p65
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6986 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- RSV
pGal4-p65 vector Map
pGal4-p65 vector Sequence
LOCUS 40924_20985 6986 bp DNA circular SYN 18-DEC-2018 DEFINITION Mammalian expression vector pGal4-p65, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6986) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6986) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6986) TITLE Direct Submission REFERENCE 4 (bases 1 to 6986) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6986 /mol_type="other DNA" /organism="synthetic DNA construct" polyA_signal complement(766..900) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" misc_feature complement(934..1723) /label=3' UTR of hNF-kappaB p65 subunit /note="3' UTR of hNF-kappaB p65 subunit" CDS complement(1727..2098) /codon_start=1 /label=RelA (p65) AD /note="transcriptional activation domain of human RelA, also known as p65 (O'Shea and Perkins, 2008)" /translation="PTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNS EFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGD EDFSSIADMDFSALLSQISS" misc_feature complement(3380..3415) /label=linker /note="linker" CDS complement(3416..3856) /codon_start=1 /label=GAL4 DNA binding domain /note="DNA binding domain of the GAL4 transcriptional activator" /translation="LKLLSSIEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTK RSPLTRAHLTEVESRLERLEQLFLLIFPREDLDMILKMDSLQDIKALLTGLFVQDNVNK DAVTDRLASVETDMPLTLRQHRISATSSSEESSNKGQRQLTVS" promoter complement(3998..4259) /label=RSV promoter /note="Rous sarcoma virus enhancer/promoter" promoter 4584..4913 /label=SV40 promoter /note="SV40 enhancer and early promoter" rep_origin complement(5159..5747) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5921..6778) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(6779..6883) /label=AmpR promoter
This page is informational only.