Basic Vector Information
- Vector Name:
- pGAD424A20ZF+
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7953 bp
- Type:
- Yeast expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- LEU2
pGAD424A20ZF+ vector Map
pGAD424A20ZF+ vector Sequence
LOCUS 40924_20935 7953 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast expression vector pGAD424A20ZF+, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7953) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 7953) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 7953) TITLE Direct Submission REFERENCE 4 (bases 1 to 7953) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7953 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 5..406 /label=ADH1 promoter /note="promoter for alcohol dehydrogenase 1" CDS 452..472 /label=SV40 NLS /note="nuclear localization signal of SV40 (simian virus 40) large T antigen" CDS 488..829 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" CDS 848..2104 /codon_start=1 /note="unnamed protein product; hA20f" /protein_id="SJL88294.1" /translation="MEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNK LPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAM KCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGI CSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQA ARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQN TIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTS RPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFG NAKCNGYCNECFQFKQMYG" terminator 2535..2722 /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" CDS complement(2843..3934) /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" promoter complement(3935..4339) /label=LEU2 promoter primer_bind complement(4381..4397) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4405..4421) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4429..4459) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4474..4495) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4783..5371) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5545..6402) /label=AmpR /note="beta-lactamase" promoter complement(6403..6507) /label=AmpR promoter rep_origin 6789..7953 /label=2u ori /note="yeast 2u plasmid origin of replication"
This page is informational only.