pGA1 vector (V006133)

LOCUS       40924_20855        3898 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pGA1, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3898)
  AUTHORS   Ross TM, Xu Y, Bright RA, Robinson HL.
  TITLE     C3d enhancement of antibodies to hemagglutinin accelerates 
            protection against influenza virus challenge
  JOURNAL   Nat. Immunol. 1 (2), 127-131 (2000)
  PUBMED    11248804
REFERENCE   2  (bases 1 to 3898)
  AUTHORS   Robinson HL, Hua J, Ross TM, Smith JM.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2001) Microbiology and Immunology, Yerkes Regional
            Primate Research Center, 954 Gatewood RD NE, Atlanta, GA 30329, USA
REFERENCE   3  (bases 1 to 3898)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3898)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat. 
            Immunol."; date: "2000"; volume: "1"; issue: "2"; pages: "127-131"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (27-SEP-2001) Microbiology and Immunology, Yerkes Regional Primate 
            Research Center, 954 Gatewood RD NE, Atlanta, GA 30329, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3898
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        93..474
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        475..678
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     intron          814..1640
                     /label=CMV intron A
                     /note="human cytomegalovirus intron A (Chapman et al.,
                     1991)"
     misc_feature    1659..1721
                     /label=tpa leader
                     /note="tpa leader"
     polyA_signal    1764..1986
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     terminator      complement(1987..2021)
                     /label=lambda t0 terminator
                     /note="minimal transcription terminator from phage lambda 
                     (Scholtissek and Grosse, 1987)"
     CDS             complement(2042..2833)
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     rep_origin      3245..3834
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"