Basic Vector Information
- Vector Name:
- pG108
- Length:
- 10344 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Jones KR, Macrina FL, Lewis JP.
pG108 vector Vector Map
pG108 vector Sequence
LOCUS V006137 10344 bp DNA circular SYN 18-DEC-2018 DEFINITION Exported. ACCESSION V006137 VERSION V006137 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 10344) AUTHORS Jones KR, Macrina FL, Lewis JP. TITLE Porphyromonas gingivalis shuttle vector JOURNAL Unpublished REFERENCE 2 (bases 1 to 10344) AUTHORS Jones KR, Macrina FL, Lewis JP. TITLE Direct Submission JOURNAL Submitted (11-JUL-2017) OCMB, Virginia Commonwealth University, Philips Institute, 521 North 11th Street, Richmond, VA 23298, USA REFERENCE 3 (bases 1 to 10344) TITLE Direct Submission REFERENCE 4 (bases 1 to 10344) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-JUL-2017) OCMB, Virginia Commonwealth University, Philips Institute, 521 North 11th Street, Richmond, VA 23298, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10344 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 688..704 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" misc_feature 705..761 /label="MCS" /note="pUC18/19 multiple cloning site" primer_bind complement(774..790) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind 798..814 /label="lac operator" /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(822..852) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(867..888) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." RBS 1448..1456 /label="Shine-Dalgarno sequence" /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" CDS 1899..3491 /codon_start=1 /gene="repB" /product="RepB" /label="repB" /protein_id="AVN57612.1" /translation="MRTFEYRSLKPFEFFQIIFGSCDHNDPQCPIYPFEKELCQEYIDW RAQQAGRKSKSKAGKKAIYNPAQPFRYNALVQAVYSVEPDAGRANDNGRRSKTWVVVGD ATSEDDIKVCGWDSLEELMGRYKFVVTTPATYVGRRRFKSNARYLYALAFDLDEVGVPE MSEVIHQQTIGMTPQANIIVNSGDGIHLYYILAKPMPLYPKVYETLTNIKKALTRLIWN KASSRTGEDNQVQIQPIIQPFRVPGSRTKHGDIVTAWHNADAPLHTIEELNRFASKPTL KYLNSGVSQEQAQAFGQRGILPRIWLTKARAKELYPDWYQKRIVEGAPRKTWHVHRGLY EWWLHMLWTNEKVAVGHRYHCIMFLAVYAKKCNVPFDILKRDALELVPRMEALTGNTGR HFSVQDALDALKAYKESSETYPRQLIEDRSGLRIEPNKRNGRPQDLHLKLARGSRDILQ EAKGRKDWREGNGRPKGSIVLAEDSPQYAKVQEWRDRNPNSNNKSRCARETGLSRPTRP QVVAKPLGNALRT" gene 1899..3491 /gene="repB" /label="repB" CDS complement(3650..4627) /codon_start=1 /gene="mob" /product="Mob" /label="mob" /note="plasmid stability" /protein_id="AVN57616.1" /translation="MSKTSIHIEPCKIGSSEQHNQRLKHLDYVRPDLSPQNESWVGVAD LPAHLEQLRILVKEKTGRAMQQKATPIREGVIVINQGTSINQLRGLATAIELRWGIKTL QIYTHKDEGHIDSDDTWKPNLHAHMVLDWVNHDTGKSIKLSKQDMAEMQTMVADCLQMV RGESSDVKHLGAIQYKNQAEELRLQTLKEQTMKEEQARELALAEAKRMEQVASEQIIAE NKKLGGLWMDWQKSFEASEKRRESITARKIEEDKLWEELGLKGAFKSFWEECKDWFRGF GDGLKDLALLIWASPRGVMDKDVRCTADRKRGKLLLKWAYTRSR" gene complement(3650..4627) /gene="mob" /label="mob" CDS complement(5642..6175) /codon_start=1 /product="hypothetical protein" /label="hypothetical protein" /note="orfE" /protein_id="AVN57613.1" /translation="MLVRGAEPMEKRQQRGLFTVPGLLLAFCSHGSSIADGLVAHPSEG FYIIYTTSSEEFLTLSEEDYSLFASFANLVVREDSNSNGLRSAKPSGDGWKFGGKGKGK LDAIHIGYELSKILGENQDFEIYVEYNGDGSYTVWYREVQKSSKGSNPVKTFNVLIRAN EREGHTVSLFQPYA" rep_origin complement(6145..6733) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7074..7808) /gene="ermBP" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Enterococcus faecalis. Accession#: P0A4D5" CDS 8314..10236 /gene="tetQ" /label="Tetracycline resistance protein TetQ" /note="Tetracycline resistance protein TetQ from Bacteroides fragilis. Accession#: Q08425"
This page is informational only.