pLentiCRISPR-E vector (V007469)

Price Information

Cat No. Plasmid Name Availability Add to cart
V007469 pLentiCRISPR-E In stock, 1 week for quality controls

Buy one, get one free!

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pLentiCRISPR-E
Antibiotic Resistance:
Ampicillin
Length:
14849 bp
Type:
Mammalian Expression, Lentiviral, CRISPR
Replication origin:
ori
Selection Marker:
Puromycin
Copy Number:
High Copy
Promoter:
SV40
Cloning Method:
Restriction Enzyme

pLentiCRISPR-E vector Map

pLentiCRISPR-E14849 bp700140021002800350042004900560063007000770084009100980010500112001190012600133001400014700pRS-markerCMV enhancerCMV promoter5' LTR (truncated)HIV-1 PsiRREgp41 peptideProtein TatcPPT/CTSU6 promotergRNA scaffoldEF-1-alpha core promotereSpCas9(1.1)nucleoplasmin NLSP2APuroRWPRE-RFactor Xa site3' LTR (Delta-U3)bGH poly(A) signalf1 oriSV40 promoterEM7 promoterBleoRSV40 poly(A) signalIn lacZ genelac promoterCAP binding siteL4440oriAmpRAmpR promoter

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pLentiCRISPR-E vector Sequence

LOCUS       V007469                14849 bp    DNA     circular SYN 13-MAY-2021
DEFINITION  Exported.
ACCESSION   V007469
VERSION     V007469
KEYWORDS    pLentiCRISPR-E
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 14849)
  AUTHORS   Sikder RK, Ellithi M, Uzzo RN, Weader D, Metz AL, Behbahani A,
            McKenzie ER, El-Deiry WS, Abbosh PH
  TITLE     Differential effects of clinically-relevant N- vs C-terminal
            truncating CDKN1A mutations on cisplatin sensitivity in bladder
            cancer.
  JOURNAL   Mol Cancer Res. 2020 Dec 3. pii: 1541-7786.MCR-19-1200. doi:
            10.1158/1541-7786.MCR-19-1200.
   PUBMED   33272936
REFERENCE   2  (bases 1 to 14849)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 14849)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Mol Cancer
            Res. 2020 Dec 3. pii: 1541-7786.MCR-19-1200. doi:
            10.1158/1541-7786.MCR-19-1200."
            SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..14849
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     complement(47..66)
                     /label="pRS-marker"
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     enhancer        238..617
                     /label="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        618..820
                     /label="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     LTR             835..1015
                     /label="5' LTR (truncated)"
                     /note="truncated 5' long terminal repeat (LTR) from HIV-1"
     misc_feature    1062..1187
                     /label="HIV-1 Psi"
                     /note="packaging signal of human immunodeficiency virus
                     type 1"
     misc_feature    1680..1913
                     /label="RRE"
                     /note="The Rev response element (RRE) of HIV-1 allows for
                     Rev-dependent mRNA export from the nucleus to the
                     cytoplasm."
     CDS             2098..2142
                     /label="gp41 peptide"
                     /note="antigenic peptide corresponding to amino acids 655
                     to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
                     al., 2013)"
     CDS             2291..2332
                     /note="Protein Tat from Human immunodeficiency virus type 1
                     group M subtype B (isolate WMJ22). Accession#: P12509"
                     /label="Protein Tat"
     misc_feature    2440..2557
                     /label="cPPT/CTS"
                     /note="central polypurine tract and central termination
                     sequence of HIV-1"
     promoter        2608..2848
                     /label="U6 promoter"
                     /note="RNA polymerase III promoter for human U6 snRNA"
     misc_RNA        4738..4813
                     /label="gRNA scaffold"
                     /note="guide RNA scaffold for the Streptococcus pyogenes
                     CRISPR/Cas9 system"
     promoter        4875..5086
                     /label="EF-1-alpha core promoter"
                     /note="core promoter for human elongation factor
                     EF-1-alpha"
     CDS             5111..9214
                     /label="eSpCas9(1.1)"
                     /note="Cas9 endonuclease from the Streptococcus pyogenes
                     Type II CRISPR/Cas system, mutated to improve targeting
                     specificity (Slaymaker et al., 2016)"
     CDS             9215..9262
                     /codon_start=1
                     /product="bipartite nuclear localization signal from
                     nucleoplasmin"
                     /label="nucleoplasmin NLS"
                     /translation="KRPAATKKAGQAKKKK"
     CDS             9272..9328
                     /codon_start=1
                     /product="2A peptide from porcine teschovirus-1
                     polyprotein"
                     /label="P2A"
                     /note="Eukaryotic ribosomes fail to insert a peptide bond
                     between the Gly and Pro residues, yielding separate
                     polypeptides."
                     /translation="ATNFSLLKQAGDVEENPGP"
     CDS             9329..9925
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /label="PuroR"
                     /note="confers resistance to puromycin"
                     /translation="TEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERV
                     TELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAA
                     QQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSA
                     PRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA"
     primer_bind     9822..9842
                     /label="Puro-F"
                     /note="Puromycin resistance gene, forward primer"
     primer_bind     complement(9994..10014)
                     /label="WPRE-R"
                     /note="WPRE, reverse primer"
     CDS             complement(10412..10423)
                     /label="Factor Xa site"
                     /note="Factor Xa recognition and cleavage site"
     LTR             10601..10834
                     /label="3' LTR (Delta-U3)"
                     /note="self-inactivating 3' long terminal repeat (LTR) from
                     HIV-1"
     polyA_signal    10866..11090
                     /label="bGH poly(A) signal"
                     /note="bovine growth hormone polyadenylation signal"
     rep_origin      11136..11564
                     /label="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        11578..11907
                     /label="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     promoter        11955..12002
                     /label="EM7 promoter"
                     /note="synthetic bacterial promoter"
     CDS             12021..12392
                     /label="BleoR"
                     /note="antibiotic-binding protein"
     polyA_signal    12525..12658
                     /label="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     primer_bind     complement(12695..12711)
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     primer_bind     complement(12695..12711)
                     /label="M13 Reverse"
                     /note="In lacZ gene. Also called M13-rev"
     primer_bind     complement(12708..12730)
                     /label="M13/pUC Reverse"
                     /note="In lacZ gene"
     protein_bind    12719..12735
                     /label="lac operator"
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(12743..12773)
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(12788..12809)
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(12926..12943)
                     /label="L4440"
                     /note="L4440 vector, forward primer"
     rep_origin      complement(13097..13685)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(13859..14716)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(14717..14821)
                     /label="AmpR promoter"