Basic Vector Information
- Vector Name:
- pELR-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9936 bp
- Type:
- MoClo end-linker vector
- Replication origin:
- oriV
- Source/Author:
- Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
pELR-1 vector Vector Map
pELR-1 vector Sequence
LOCUS V007579 9936 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007579 VERSION V007579 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 9936) AUTHORS Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S. TITLE A modular cloning system for standardized assembly of multigene constructs JOURNAL PLoS ONE 6 (2), E16765 (2011) PUBMED 21364738 REFERENCE 2 (bases 1 to 9936) AUTHORS Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S. TITLE Direct Submission JOURNAL Submitted (20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22, Halle/Saale 06120, Germany REFERENCE 3 (bases 1 to 9936) TITLE Direct Submission REFERENCE 4 (bases 1 to 9936) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE"; date: "2011"; volume: "6"; issue: "2"; pages: "E16765" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22, Halle/Saale 06120, Germany" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9936 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 228..1133 /gene="crtE" /label="Geranylgeranyl diphosphate synthase" /note="Geranylgeranyl diphosphate synthase from Pantoea ananas. Accession#: P21684" CDS 1146..1874 /codon_start=1 /gene="crtW" /product="beta-carotene ketolase" /label="crtW" /protein_id="ADZ30896.1" /translation="MSAHALPKADLTATSLIVSGGIIAAWLALHVHALWFLDAAAHPIL AIANFLGLTWLSVGLFIIAHDAMHGSVVPGRPRANAAMGQLVLWLYAGFSWRKMIVKHM AHHRHAGTDDDPDFDHGGPVRWYARFIGTYFGWREGLLLPVIVTVYALILGDRWMYVVF WPLPSILASIQLFVFGTWLPHRPGHDAFPDRHNARSSRISDPVSLLTCFHFGGYHHEHH LHPTVPWWRLPSTRTKGDTA" gene 1146..1874 /gene="crtW" /label="crtW" regulatory 1502..1511 /note="vertebrate consensus sequence for strong initiation of translation (Kozak, 1987)" /regulatory_class="other" CDS 1896..3041 /gene="crtY" /label="Lycopene beta-cyclase" /note="Lycopene beta-cyclase from Pantoea ananas. Accession#: P21687" CDS 3056..4531 /gene="crtI" /label="Phytoene desaturase (lycopene-forming)" /note="Phytoene desaturase (lycopene-forming) from Pantoea ananas. Accession#: P21685" CDS 4531..5457 /gene="crtB" /label="15-cis-phytoene synthase" /note="15-cis-phytoene synthase from Pantoea ananas. Accession#: P21683" misc_feature 5577..5580 /note="fusion site; other site" misc_feature 5615..5639 /label="RB T-DNA repeat" /note="right border repeat from nopaline C58 T-DNA" CDS complement(5798..6943) /label="trfA" /note="trans-acting replication protein that binds to and activates oriV" rep_origin complement(7279..7867) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(8041..8898) /label="AmpR" /note="beta-lactamase" promoter complement(8899..9003) /label="AmpR promoter" rep_origin complement(9020..9729) /direction=LEFT /label="oriV" /note="incP origin of replication" misc_feature 9813..9837 /label="LB T-DNA repeat" /note="left border repeat from nopaline C58 T-DNA" misc_feature 9926..9929 /note="fusion site; other site"
This page is informational only.