Basic Vector Information
- Vector Name:
- pELR-1
- Antibiotic Resistance:
- Ampicillin
- Length:
- 9936 bp
- Type:
- MoClo end-linker vector
- Replication origin:
- oriV
- Source/Author:
- Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
pELR-1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pELR-1 vector Sequence
LOCUS 40924_17334 9936 bp DNA circular SYN 17-DEC-2018
DEFINITION MoClo end-linker vector pELR-1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 9936)
AUTHORS Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
TITLE A modular cloning system for standardized assembly of multigene
constructs
JOURNAL PLoS ONE 6 (2), E16765 (2011)
PUBMED 21364738
REFERENCE 2 (bases 1 to 9936)
AUTHORS Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
TITLE Direct Submission
JOURNAL Submitted (20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22,
Halle/Saale 06120, Germany
REFERENCE 3 (bases 1 to 9936)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9936)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
date: "2011"; volume: "6"; issue: "2"; pages: "E16765"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22, Halle/Saale 06120,
Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9936
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 228..1133
/gene="crtE"
/label=crtE
/note="Geranylgeranyl diphosphate synthase from Pantoea
ananas. Accession#: P21684"
CDS 1146..1874
/codon_start=1
/gene="crtW"
/product="beta-carotene ketolase"
/label=crtW
/protein_id="ADZ30896.1"
/translation="MSAHALPKADLTATSLIVSGGIIAAWLALHVHALWFLDAAAHPIL
AIANFLGLTWLSVGLFIIAHDAMHGSVVPGRPRANAAMGQLVLWLYAGFSWRKMIVKHM
AHHRHAGTDDDPDFDHGGPVRWYARFIGTYFGWREGLLLPVIVTVYALILGDRWMYVVF
WPLPSILASIQLFVFGTWLPHRPGHDAFPDRHNARSSRISDPVSLLTCFHFGGYHHEHH
LHPTVPWWRLPSTRTKGDTA"
gene 1146..1874
/gene="crtW"
/label=crtW
regulatory 1502..1511
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 1896..3041
/gene="crtY"
/label=crtY
/note="Lycopene beta-cyclase from Pantoea ananas.
Accession#: P21687"
CDS 3056..4531
/gene="crtI"
/label=crtI
/note="Phytoene desaturase (lycopene-forming) from Pantoea
ananas. Accession#: P21685"
CDS 4531..5457
/gene="crtB"
/label=crtB
/note="15-cis-phytoene synthase from Pantoea ananas.
Accession#: P21683"
misc_feature 5577..5580
/note="fusion site; other site"
misc_feature 5615..5639
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS complement(5798..6943)
/label=trfA
/note="trans-acting replication protein that binds to and
activates oriV"
rep_origin complement(7279..7867)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(8041..8898)
/label=AmpR
/note="beta-lactamase"
promoter complement(8899..9003)
/label=AmpR promoter
rep_origin complement(9020..9729)
/direction=LEFT
/label=oriV
/note="incP origin of replication"
misc_feature 9813..9837
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
misc_feature 9926..9929
/note="fusion site; other site"
This page is informational only.