Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V006702 | pHR-scFv-GCN4-sfGFP-GB1-dWPRE | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pHR-scFv-GCN4-sfGFP-GB1-dWPRE
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10059 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- SFFV
pHR-scFv-GCN4-sfGFP-GB1-dWPRE vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pHR-scFv-GCN4-sfGFP-GB1-dWPRE vector Sequence
LOCUS V006702 10059 bp DNA circular SYN 13-MAY-2021
DEFINITION Exported.
ACCESSION V006702
VERSION V006702
KEYWORDS pHR-scFv-GCN4-sfGFP-GB1-dWPRE
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 10059)
AUTHORS Tanenbaum ME, Gilbert LA, Qi LS, Weissman JS, Vale RD
TITLE A Protein-Tagging System for Signal Amplification in Gene Expression
and Fluorescence Imaging.
JOURNAL Cell. 2014 Oct 8. pii: S0092-8674(14)01227-6. doi:
10.1016/j.cell.2014.09.039.
PUBMED 25307933
REFERENCE 2 (bases 1 to 10059)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 10059)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell. 2014
Oct 8. pii: S0092-8674(14)01227-6. doi: 10.1016/j.cell.2014.09.039."
SGRef: number: 2; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10059
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter complement(16..34)
/label="SP6 promoter"
/note="promoter for bacteriophage SP6 RNA polymerase"
primer_bind complement(324..343)
/label="pBRrevBam"
/note="pBR322 vectors, tet region, downstream of BamHI,
reverse primer"
primer_bind complement(557..576)
/label="pRS-marker"
/note="pRS vectors, use to sequence yeast selectable
marker"
primer_bind 676..698
/label="pGEX 3'"
/note="pGEX vectors, reverse primer"
primer_bind complement(736..754)
/label="pBRforEco"
/note="pBR322 vectors, upsteam of EcoRI site, forward
primer"
promoter 822..926
/label="AmpR promoter"
CDS 927..1784
/label="AmpR"
/note="beta-lactamase"
rep_origin 1958..2546
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
primer_bind 2700..2717
/label="L4440"
/note="L4440 vector, forward primer"
promoter 2792..3121
/label="SV40 promoter"
/note="SV40 enhancer and early promoter"
intron 4255..4320
/label="small t intron"
/note="SV40 (simian virus 40) small t antigen intron"
CDS 4450..4470
/label="SV40 NLS"
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 4895..5029
/label="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
LTR 5197..5830
/label="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 5877..6002
/label="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
misc_feature 6499..6732
/label="RRE"
/note="The Rev response element (RRE) of HIV-1 allows for
Rev-dependent mRNA export from the nucleus to the
cytoplasm."
CDS 6917..6961
/label="gp41 peptide"
/note="antigenic peptide corresponding to amino acids 655
to 669 of the HIV envelope protein gp41 (Lutje Hulsik et
al., 2013)"
CDS 7110..7151
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate WMJ22). Accession#: P12509"
/label="Protein Tat"
misc_feature 7246..7363
/label="cPPT/CTS"
/note="central polypurine tract and central termination
sequence of HIV-1"
promoter 7516..7923
/label="SFFV promoter"
/note="spleen focus-forming virus long terminal repeat
(LTR) promoter"
regulatory 7957..7966
/label="Kozak sequence"
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
CDS 8704..8730
/label="HA"
/note="HA (human influenza hemagglutinin) epitope tag"
CDS 8821..9531
/label="superfolder GFP"
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Nager et al., 2011)"
CDS 9553..9714
/codon_start=1
/product="B1 domain of Streptococcal protein G "
/label="GB1"
/note="effective as a solubilizing fusion partner (Cheng
and Patel, 2004)"
/translation="YKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDD
ATKTFTVTE"
LTR 9817..10050
/label="3' LTR (Delta-U3)"
/note="self-inactivating 3' long terminal repeat (LTR) from
HIV-1"