MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP vector (V006838) Gene synthesis in MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V006838 MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

The plasmid is a retroviral mammalian expression vector, which is used to express the human p210BCR-ABL protein in mammalian cells.

Vector Name:
MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP
Antibiotic Resistance:
Ampicillin
Length:
13502 bp
Type:
Mammalian Expression, Retroviral
Replication origin:
ori
Copy Number:
High Copy
Promoter:
MSCV
Cloning Method:
Restriction Enzyme
5' Primer:
pLXSN5'
3' Primer:
pCDH-rev
Growth Strain(s):
Stbl3

MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP vector Map

MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP13502 bp6001200180024003000360042004800540060006600720078008400900096001020010800114001200012600132005' LTRMESV Psigag (truncated)p210 BCRTyrosine-protein kinase ABL1IRESEGFP3' LTRlac operatorlac promoterCAP binding siteL4440oriAmpRAmpR promoterpBRforEcopGEX 3'pRS-markerIn lacZ genepBRrevBam

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP vector Sequence

LOCUS       Exported               13502 bp DNA     circular SYN 05-JUN-2025
DEFINITION  Exported.
ACCESSION   V006838
VERSION     .
KEYWORDS    MSCV-(pBabe mcs)- human p210BCR-ABL-IRES-GFP
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 13502)
  TITLE     Roussel lab plasmids
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 13502)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 13502)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 13502)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..13502
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     LTR             1..517
                     /label=5' LTR
                     /note="5' long terminal repeat from murine embryonic stem
                     cell virus"
     misc_feature    581..922
                     /label=MESV Psi
                     /note="packaging signal of murine embryonic stem cell
                     virus"
     CDS             989..1405
                     /label=gag (truncated)
                     /note="truncated Moloney murine leukemia virus (MMLV) gag
                     gene lacking the start codon"
     CDS             1538..4318
                     /codon_start=1
                     /label=p210 BCR
                     /translation="MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRL
                     EQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADG
                     ADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRK
                     GHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSS
                     VGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQS
                     IYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTS
                     SEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVV
                     SEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDD
                     SPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHL
                     EALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQR
                     VGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTT
                     KNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITP
                     RRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDC
                     KWYIPLTDLSFQMVDELEAVPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKATE
                     RLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRENIREQQKKCFRS
                     FSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSS"
     CDS             4319..7630
                     /gene="ABL1"
                     /label=Tyrosine-protein kinase ABL1
                     /note="Tyrosine-protein kinase ABL1 from Homo sapiens. 
                     Accession#: P00519"
     misc_feature    8452..9013
                     /label=IRES
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     CDS             9016..9732
                     /label=EGFP
                     /note="enhanced GFP"
     LTR             9897..10411
                     /label=3' LTR
                     /note="3' long terminal repeat from murine embryonic stem
                     cell virus"
     protein_bind    10573..10589
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(10597..10627)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(10642..10663)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     primer_bind     complement(10780..10797)
                     /label=L4440
                     /note="L4440 vector, forward primer"
     rep_origin      complement(10951..11539)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(11713..12570)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(12571..12675)
                     /label=AmpR promoter
     primer_bind     12743..12761
                     /label=pBRforEco
                     /note="pBR322 vectors, upsteam of EcoRI site, forward
                     primer"
     primer_bind     complement(12799..12821)
                     /label=pGEX 3'
                     /note="pGEX vectors, reverse primer"
     primer_bind     12921..12940
                     /label=pRS-marker
                     /note="pRS vectors, use to sequence yeast selectable
                     marker"
     primer_bind     13134..13156
                     /label=M13/pUC Forward
                     /note="In lacZ gene"
     primer_bind     13284..13303
                     /label=pBRrevBam
                     /note="pBR322 vectors, tet region, downstream of BamHI,
                     reverse primer"