Basic Vector Information
- Vector Name:
- pEGFP-RhoA Biosensor
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6140 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Selection Marker:
- Neomycin (select with G418)
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- CATGGACGAGCTGTACAAG
pEGFP-RhoA Biosensor vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEGFP-RhoA Biosensor vector Sequence
LOCUS 40924_17229 6140 bp DNA circular SYN 13-MAY-2021 DEFINITION C-terminus of Anillin in mammalian expression vector pEGFP-C1. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6140) AUTHORS Piekny AJ, Glotzer M TITLE Anillin is a scaffold protein that links RhoA, actin, and myosin during cytokinesis. JOURNAL Curr Biol. 2008 Jan 8;18(1):30-6. Epub 2007 Dec 27. PUBMED 18158243 REFERENCE 2 (bases 1 to 6140) TITLE Direct Submission REFERENCE 3 (bases 1 to 6140) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr Biol."; date: "2008-01-8"; volume: "18(1)"; pages: "30-6. Epub 2007 Dec 27" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..6140 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 68..371 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 372..575 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 620..1336 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" polyA_signal 2935..3056 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3063..3518) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3545..3649 /label=AmpR promoter promoter 3651..4008 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 4043..4834 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" primer_bind complement(5025..5044) /label=TK-pA-R /note="Thymidine kinase polyA, reverse primer" polyA_signal 5069..5116 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 5445..6033 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.