Basic Vector Information
- Vector Name:
- pEGFP-C1-AR
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7942 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Selection Marker:
- Neomycin (select with G418)
- Copy Number:
- High Copy
- Promoter:
- CMV
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- EGFP-C
- 3' Primer:
- SV40pA-R
pEGFP-C1-AR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEGFP-C1-AR vector Sequence
LOCUS 40924_17139 7942 bp DNA circular SYN 13-MAY-2021 DEFINITION Mammalian expression of Androgen receptor fused to EGFP. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7942) AUTHORS Stenoien DL, Cummings CJ, Adams HP, Mancini MG, Patel K, DeMartino GN, Marcelli M, Weigel NL, Mancini MA TITLE Polyglutamine-expanded androgen receptors form aggregates that sequester heat shock proteins, proteasome components and SRC-1, and are suppressed by the HDJ-2 chaperone. JOURNAL Hum Mol Genet. 1999 May . 8(5):731-41. PUBMED 10196362 REFERENCE 2 (bases 1 to 7942) TITLE Direct Submission REFERENCE 3 (bases 1 to 7942) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Hum Mol Genet. 1999 May . 8(5):731-41." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..7942 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 86..389 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 390..593 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 638..1354 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" polyA_signal 4755..4876 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(4883..5338) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 5365..5469 /label=AmpR promoter promoter 5471..5828 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 5863..6654 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" primer_bind complement(6845..6864) /label=TK-pA-R /note="Thymidine kinase polyA, reverse primer" polyA_signal 6889..6936 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 7265..7853 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.