Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V007079 | PL-SIN-PGK-EGFP | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- PL-SIN-PGK-EGFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6846 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- mPGK
PL-SIN-PGK-EGFP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
PL-SIN-PGK-EGFP vector Sequence
LOCUS 40924_27189 6846 bp DNA circular SYN 13-MAY-2021 DEFINITION Control Lentiviral vector with ubiquitous PGK promoter, expresses EGFP. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6846) AUTHORS Hotta A, Cheung AY, Farra N, Vijayaragavan K, Seguin CA, Draper JS, Pasceri P, Maksakova IA, Mager DL, Rossant J, Bhatia M, Ellis J TITLE Isolation of human iPS cells using EOS lentiviral vectors to select for pluripotency. JOURNAL Nat Methods. 2009 May . 6(5):370-6. PUBMED 19404254 REFERENCE 2 (bases 1 to 6846) TITLE Direct Submission REFERENCE 3 (bases 1 to 6846) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Methods. 2009 May . 6(5):370-6." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..6846 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(29..51) /label=pGEX 3' /note="pGEX vectors, reverse primer" primer_bind 151..170 /label=pRS-marker /note="pRS vectors, use to sequence yeast selectable marker" primer_bind 379..395 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" LTR 785..1042 /label=5' LTR (truncated) /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 1089..1214 /label=HIV-1 Psi /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1693..1810 /label=cPPT/CTS /note="central polypurine tract and central termination sequence of HIV-1" misc_feature 2200..2433 /label=RRE /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." promoter 2768..3267 /label=PGK promoter /note="mouse phosphoglycerate kinase 1 promoter" CDS 3287..4003 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" LTR 4133..4366 /label=3' LTR (Delta-U3) /note="self-inactivating 3' long terminal repeat (LTR) from HIV-1" protein_bind complement(4414..4430) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4438..4468) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4483..4504) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." primer_bind complement(4621..4638) /label=L4440 /note="L4440 vector, forward primer" rep_origin complement(4792..5380) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5849..6226) /label=ISS /note="immunostimulatory sequence from the AmpR gene; contains unmethylated CpG dinucleotides in the context of 5'-AACGTT-3' (Sato et al., 1996)" promoter complement(6411..6515) /label=AmpR promoter promoter complement(6552..6747) /label=SV40 promoter /note="SV40 early promoter" primer_bind 6819..6837 /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer"