Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V007171 | pMaster12 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pMaster12
- Antibiotic Resistance:
- Ampicillin
- Length:
- 27879 bp
- Type:
- Mammalian Expression
- Replication origin:
- ori
- Selection Marker:
- Neomycin (select with G418) ; tk
- Copy Number:
- High Copy
- Promoter:
- CAG
pMaster12 vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pMaster12 vector Sequence
LOCUS 40924_29821 27879 bp DNA circular UNA 13-MAY-2021 DEFINITION Reprogram somatic cells to iPS cells. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 27879) AUTHORS Wu S, Wu Y, Zhang X, Capecchi MR TITLE Efficient germ-line transmission obtained with transgene-free induced pluripotent stem cells. JOURNAL Proc Natl Acad Sci U S A. 2014 Jul 22;111(29):10678-83. doi: 10.1073/pnas.1409933111. Epub 2014 Jul 7. PUBMED 25002522 REFERENCE 2 (bases 1 to 27879) TITLE Direct Submission REFERENCE 3 (bases 1 to 27879) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; doi: "10.1073/pnas.1409933111"; journalName: "Proc Natl Acad Sci U S A"; date: "2014-07-22- 22"; volume: "111"; issue: "29"; pages: "10678-83" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..27879 /mol_type="genomic DNA" /organism="synthetic DNA construct" polyA_signal 87..134 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" promoter complement(1891..3069) /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" polyA_signal complement(3090..3137) /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(3372..4172) /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase from Tn5" /translation="MGSAIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQ GRPVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQD LLSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE EHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ DIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" misc_feature complement(4173..4759) /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS complement(4778..5905) /codon_start=1 /label=HSV TK /note="herpes simplex virus thymidine kinase" /translation="MASYPGHQHASAFDQAARSRGHSNRRTALRPRRQQEATEVRPEQK MPTLLRVYIDGPHGMGKTTTTQLLVALGSRDDIVYVPEPMTYWRVLGASETIANIYTTQ HRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSSHAPPPALTLIFDR HPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQR PGERLDLAMLAAIRRVYGLLANTVRYLQCGGSWREDWGQLSGTAVPPQGAEPQSNAGPR PHIGDTLFTLFRAPELLAPNGDLYNVFAWALDVLAKRLRSMHVFILDYDQSPAGCRDAL LQLTSGMVQTHVTTPGSIPTICDLARTFAREMGEAN" intron complement(5978..6986) /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" promoter complement(6987..7262) /label=chicken beta-actin promoter enhancer 7265..7568 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" rep_origin 7694..8149 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" polyA_signal complement(8156..8277) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" CDS complement(8404..9720) /codon_start=1 /label=c-Myc /note="human c-Myc proto-oncogene" /translation="MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTE LLGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPN PARGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDS LLSSTESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGS PSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNR KCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKA TAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA" CDS complement(9721..9780) /codon_start=1 /product="2A peptide from equine rhinitis A virus polyprotein" /label=E2A /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="QCTNYALLKLAGDVESNPGP" CDS complement(9790..10740) /codon_start=1 /label=hSOX2 /note="Homo sapiens transcription factor SOX-2 gene. Belongs to the SRY-related HMG-box (SOX) family of transcription factors, which is involved in the regulation of embryonic development and in the determination of cell fate" /translation="MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPM NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKE HPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHM NGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPT YSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGA EVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM" CDS complement(10741..10794) /codon_start=1 /product="2A peptide from Thosea asigna virus capsid protein" /label=T2A /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="EGRGSLLTCGDVEENPGP" CDS complement(10804..12213) /codon_start=1 /label=hKLF4 /note="Homo sapiens Kruppel-like factor 4 (Klf4) gene. Belongs to the relatively large family of SP1-like transcription factors and is involved in the regulation of proliferation, differentiation, apoptosis and somatic cell reprogramming." /translation="MAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRL PPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSL THPPESVAATVSSSASASSSSSPSSSGPASAPSTCSFTYPIRAGNDPGVAPGGTGGGLL YGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVL KASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGA GPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYP SFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYT KSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSR SDHLALHMKRHF" CDS complement(12214..12279) /codon_start=1 /product="2A peptide from foot-and-mouth disease virus polyprotein" /label=F2A /note="Eukaryotic ribosomes fail to insert a peptide bond between the Gly and Pro residues, yielding separate polypeptides." /translation="VKQTLNFDLLKLAGDVESNPGP" CDS complement(12289..13368) /codon_start=1 /label=hOct4 /note="Homo sapiens Oct-4 gene. Encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression in adult tissues is associated with tumorigenesis." /translation="MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGP GIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVE SNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT QADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICK AETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNR RQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFP EGEAFPPVSVTTLGSPMHSN" promoter complement(13382..14560) /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" enhancer 14667..14970 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 14973..15248 /label=chicken beta-actin promoter intron 15249..16257 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" polyA_signal 17251..17372 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(17880..19641) /direction=LEFT /label=oriP /note="Epstein-Barr virus oriP replication origin (Yates et al., 2000)" CDS complement(19946..21868) /codon_start=1 /label=EBNA1 /note="Epstein-Barr nuclear antigen 1, also known as EBNA-1" /translation="MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGR GRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAG AGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGA GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGG GAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAG GGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRG GSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPP PGRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGR RKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSL YNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLK DAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDE GEEGQE" primer_bind complement(22303..22321) /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer" promoter 22389..22493 /label=AmpR promoter CDS 22494..23351 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 23525..24113 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(24344..24568) /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" CDS complement(24603..25229) /codon_start=1 /label=hLIN28A /note="Human lin-28 homolog A gene. Encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in development, self-renewal of embryonic stem cells and metabolism. Overexpressed in human embryonic stem cells, primary human tumors and human cancer cell lines." /translation="MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICK WFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGL ESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHF CQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN" CDS complement(25230..25295) /codon_start=1 /label=F2A /note="2A peptide from foot-and-mouth disease virus polyprotein" /translation="VKQTLNFDLLKLAGDVESNPGP" CDS complement(25305..26219) /codon_start=1 /label=hNanog /note="Homo sapiens nanog homeobox gene. Encodes a DNA-binding homeobox-family transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency." /translation="MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEM PHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSS TQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSN GVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWN TQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTT RYFSTPQTMDLFLNYSMNMQPEDV" intron complement(26288..27296) /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin" promoter complement(27297..27572) /label=chicken beta-actin promoter enhancer complement(27575..27878) /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer"