Basic Vector Information
- Vector Name:
- pCR3VSV-CED-4
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6734 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pCR3VSV-CED-4 vector Map
pCR3VSV-CED-4 vector Sequence
LOCUS 40924_13290 6734 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCR3VSV-CED-4, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6734) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6734) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6734) TITLE Direct Submission REFERENCE 4 (bases 1 to 6734) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6734 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 10..389 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 390..593 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" promoter 638..656 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 691..723 /label=VSV-G tag /note="epitope tag from vesicular stomatitis virus G protein" CDS 736..2385 /codon_start=1 /note="unnamed protein product; CED-4" /protein_id="SJL88336.1" /translation="MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELIS KMSTRLERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPV VIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGS GKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPS VEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAA SQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSC EPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVM PPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDH IIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPK TTEETVIRPEDFPKFMQLHQKFYDSLKNFACC" promoter complement(2449..2467) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" polyA_signal 2493..2717 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin complement(2849..3437) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" polyA_signal complement(3766..3813) /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" CDS complement(4048..4833) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" promoter complement(4868..5225) /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS complement(5288..6145) /label=AmpR /note="beta-lactamase" promoter complement(6146..6250) /label=AmpR promoter rep_origin 6277..6732 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.