Basic Vector Information
- Vector Name:
- pCR2.1-sacB
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5522 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rholl D, Bruckbauer S.
- Promoter:
- T7
pCR2.1-sacB vector Map
pCR2.1-sacB vector Sequence
LOCUS 40924_13230 5522 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCR2.1-sacB, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5522) AUTHORS Rholl D, Bruckbauer S. TITLE Direct Submission JOURNAL Submitted (05-FEB-2013) Microbiology Immunology and Pathology, Colorado State University, IDRC at Foothills Campus, Campus Delivery 0922, Fort Collins, CO 80523-0922, USA REFERENCE 2 (bases 1 to 5522) TITLE Direct Submission REFERENCE 3 (bases 1 to 5522) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (05-FEB-2013) Microbiology Immunology and Pathology, Colorado State University, IDRC at Foothills Campus, Campus Delivery 0922, Fort Collins, CO 80523-0922, USA" COMMENT SGRef: number: 2; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..5522 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(70..88) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(95..111) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 253..633 /label=M13 ori /note="M13 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS 1001..1792 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SRLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKARMPDGEDLVVIHGDACLPNIMVENGRFSGFNDCGRLGVADRYQDIA LDTRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" CDS 1813..2670 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCHTLLSRIDAGQEQLGRRARYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDESDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" rep_origin 2844..3432 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3720..3741 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3756..3786 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3794..3810 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3818..3834 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 4084..5436 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="GATQAFAKETNQKPYKETYGISHITRHDMLQIPEQQKNEKYQVSE FDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYHIVFALAGDPKNADDTSIYMFYQ KVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEWSGSATFTSDGKIRLFYTDFSGK HYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDGKTYQNVQQFIDEGNYSSGDNHT LRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKAYYGKSTSFFRQESQKLLQSDKK RTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDEIERANVFKMNGKWYLFTDSRGS KMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLKMDLDPNDVTFTYSHFAVPQAKG NNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSVVKDSILEQGQLTVNK" terminator complement(5453..5496) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.