Basic Vector Information
- Vector Name:
- pCPC51
- Antibiotic Resistance:
- Kanamycin
- Length:
- 11513 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chang P, Wang W, Chen J.
- Promoter:
- SP6
pCPC51 vector Map
pCPC51 vector Sequence
LOCUS 40924_13025 11513 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCPC51, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11513) AUTHORS Chang P, Wang W, Chen J. TITLE Fast and convenient doxycycline-induced marker recycling in Candida albicans via Cre-loxP system JOURNAL Unpublished REFERENCE 2 (bases 1 to 11513) AUTHORS Chang P, Wang W, Chen J. TITLE Direct Submission JOURNAL REFERENCE 3 (bases 1 to 11513) TITLE Direct Submission REFERENCE 4 (bases 1 to 11513) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (30-JAN-2018) Research Center of Bioenergy " COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11513 /mol_type="other DNA" /organism="synthetic DNA construct" promoter complement(365..383) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(390..406) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 544..843 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" CDS 1195..1986 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" CDS 2196..2567 /label=BleoR /note="antibiotic-binding protein" rep_origin 2708..3296 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3603..3624 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3639..3669 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3677..3693 /label=lac operator /bound_moiety="lac repressor encoded by lacI" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3701..3717 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 3735..3753 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" misc_feature 3875..5016 /label=5' region of HIS1 gene /note="5' region of HIS1 gene" regulatory 5032..5766 /label=ADH1 promoter from Candida albicans SC5314 /note="ADH1 promoter from Candida albicans SC5314" /regulatory_class="promoter" CDS 5767..6384 /label=TetR /note="tetracycline repressor TetR" CDS 6406..6747 /label=GAL4 activation domain /note="activation domain of the GAL4 transcriptional activator" regulatory 6765..7071 /label=ACT1 terminator from Candida albicans SC5314 /note="ACT1 terminator from Candida albicans SC5314" /regulatory_class="terminator" CDS 7418..8824 /codon_start=1 /product="argininosuccinate lyase Arg4" /label=argininosuccinate lyase Arg4 /note="ARG4 gene from Candida albicans SC5314; ARG4" /protein_id="AVR52680.1" /translation="MSQQQDKQPSENKLWGGRFTGATDPLMDLYNASLPYDKVMYDADL TGTKVYTQGLNKLGLITTEELHLIHQGLEQIRQEWHDNKFIIKAGDEDIHTANERRLGE IIGKNISGKVHTGRSRNDQVATDMRIFVRESLLNLSKILHQFITAILERAHKEIDVLMP GYTHLQKAQPIRWAHWLSSYATYFTEDYKRLQEIITRVNQSPLGSGALAGHPYGIDREF LAKGLGFDGVIGNSLTAVSDRDFVVESLFWSTLFMNHISRFSEDLIIYSSGEFGFIKLA DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLSGFLMSIKSIPSTYNKDMQEDKEPLF DALTTVEHSILIATGVISTLLIDKQNMEKALTMDMLATDLADYLVRKGVPFRETHHISG ECVRKAEEEKLSGIDQLSFEQFQQIDSRFEKDVMETFDFEASVERRDAIGGTAKSAVLK QLENLKSILS" protein_bind 9180..9450 /label=tetracycline response element /note="contains seven copies of the tetracycline operator tetO" CDS 9849..10877 /label=Cre /note="site-specific recombinase"
This page is informational only.