Basic Vector Information
- Vector Name:
- pCotG-NL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6340 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T, Obuchowski M.
pCotG-NL vector Vector Map
pCotG-NL vector Sequence
LOCUS V008274 6340 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008274 VERSION V008274 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 6340) AUTHORS Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T, Obuchowski M. TITLE Vector system for spore sufrace display JOURNAL Unpublished REFERENCE 2 (bases 1 to 6340) AUTHORS Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T, Obuchowski M. TITLE Direct Submission JOURNAL Submitted (24-OCT-2013) Laboratory of Molecular Bacteriology, Medical University of Gdansk, Debinki 1, Gdansk 80-211, Poland REFERENCE 3 (bases 1 to 6340) TITLE Direct Submission REFERENCE 4 (bases 1 to 6340) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: Vector NTI Advanced v. 10 Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-OCT-2013) Laboratory of Molecular Bacteriology, Medical University of Gdansk, Debinki 1, Gdansk 80-211, Poland" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6340 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 372..1688 /gene="lysA" /label="Diaminopimelate decarboxylase" /note="Diaminopimelate decarboxylase from Bacillus subtilis (strain 168). Accession#: P23630" misc_recomb complement(1806..2192) /label="pyrD" /note="pyrD" promoter 2714..2818 /label="AmpR promoter" CDS 2819..3676 /label="AmpR" /note="beta-lactamase" rep_origin 3850..4438 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_recomb complement(4666..5133) /label="pyrD" /note="pyrD" gene 5633..6335 /gene="cotG" /label="cotG" regulatory 5633..5675 /gene="cotG" /regulatory_class="promoter" regulatory 5708..5713 /gene="cotG" /regulatory_class="ribosome_binding_site" CDS 5721..6335 /codon_start=1 /gene="cotG" /product="CotG" /label="cotG" /note="spore coat protein" /protein_id="AHG54622.1" /translation="MGILELGGGGSHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSH KKSHRTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSH KKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRS HKKYYKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK" misc_feature 5725..5738 /gene="cotG" /label="multiple cloning site" /note="multiple cloning site"
This page is informational only.