pCotG-N vector (V008275)

LOCUS       V008275                 6328 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008275
VERSION     V008275
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6328)
  AUTHORS   Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T,
            Obuchowski M.
  TITLE     Vector system for spore sufrace display
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6328)
  AUTHORS   Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T,
            Obuchowski M.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2013) Laboratory of Molecular Bacteriology,
            Medical University of Gdansk, Debinki 1, Gdansk 80-211, Poland
REFERENCE   3  (bases 1 to 6328)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6328)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vectro NTI Advanced v. 10
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (24-OCT-2013) Laboratory of Molecular Bacteriology, Medical
            University of Gdansk, Debinki 1, Gdansk 80-211, Poland"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6328
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             372..1688
                     /gene="lysA"
                     /label="Diaminopimelate decarboxylase"
                     /note="Diaminopimelate decarboxylase from Bacillus subtilis
                     (strain 168). Accession#: P23630"
     misc_recomb     complement(1806..2192)
                     /label="pyrD"
                     /note="pyrD"
     promoter        2714..2818
                     /label="AmpR promoter"
     CDS             2819..3676
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      3850..4438
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_recomb     complement(4666..5133)
                     /label="pyrD"
                     /note="pyrD"
     gene            5633..6323
                     /gene="cotG"
                     /label="cotG"
     regulatory      5633..5675
                     /gene="cotG"
                     /regulatory_class="promoter"
     regulatory      5708..5713
                     /gene="cotG"
                     /regulatory_class="ribosome_binding_site"
     CDS             5721..6323
                     /codon_start=1
                     /gene="cotG"
                     /product="CotG"
                     /label="cotG"
                     /note="spore coat protein"
                     /protein_id="AHG54619.1"
                     /translation="MGILELGHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSHKKSH
                     RTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSHKKSR
                     SYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRSHKKY
                     YKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK"
     misc_feature    5725..5738
                     /gene="cotG"
                     /label="multiple cloning site"
                     /note="multiple cloning site"