Basic Vector Information
- Vector Name:
- pCORE6
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8237 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Chandran S, Noskov VN, Segall-Shapiro TH, Ma L, Whiteis C, Lartigue C, Jores J, Vashee S, Chuang R.
- Promoter:
- GAL1
pCORE6 vector Vector Map
pCORE6 vector Sequence
LOCUS V008287 8237 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008287 VERSION V008287 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8237) AUTHORS Chandran S, Noskov VN, Segall-Shapiro TH, Ma L, Whiteis C, Lartigue C, Jores J, Vashee S, Chuang R. TITLE TREC-IN: gene knock-in genetic tool for genomes cloned in yeast JOURNAL BMC Genomics 15 (1), 1180 (2014) PUBMED 25539750 REFERENCE 2 (bases 1 to 8237) AUTHORS Chuang R-Y., Noskov V, Ma L. TITLE Direct Submission JOURNAL Submitted (17-DEC-2014) Synthetic Biology, J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA REFERENCE 3 (bases 1 to 8237) TITLE Direct Submission REFERENCE 4 (bases 1 to 8237) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "BMC Genomics"; date: "2014"; volume: "15"; issue: "1"; pages: "1180" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (17-DEC-2014) Synthetic Biology, J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8237 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 315..502 /label="HIS3 promoter" CDS 503..1159 /label="HIS3" /note="imidazoleglycerol-phosphate dehydratase, required for histidine biosynthesis" rep_origin complement(1423..1878) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 2023..2039 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 2046..2064 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" primer_bind 2097..2113 /label="SK primer" /note="common sequencing primer, one of multiple similar variants" misc_feature 2118..2131 /label="I-SceI restriction site" /note="I-SceI restriction site" promoter 2133..2574 /label="GAL1 promoter" /note="inducible promoter, regulated by Gal4" CDS 2597..3301 /gene="SCEI" /label="Intron-encoded endonuclease I-SceI" /note="Intron-encoded endonuclease I-SceI from Saccharomyces cerevisiae (strain ATCC 204508 / S288c). Accession#: P03882" CDS complement(3379..4182) /codon_start=1 /gene="ura3" /product="Ura3" /label="ura3" /protein_id="AJD09819.1" /translation="MSTKSYTSRAETHASPVASKLLRLMDEKKTNLCASLDVRSTDELL KLVETLGPYICLLKTHVDILDDFSYEGTVVPLKALAEKYKFLIFEDRKFADIGNTVKLQ YTSGVYRIAEWSDITNAHGVTGAGIVAGLKQGAQEVTKEPRGLLMLAELSSKGSLAHGE YTKGTVDIAKSDKDFVIGFIAQNDMGGREEGFDWLIMTPGVGLDDKGDALGQQYRTVDE VVSGGSDIIIVGRGLFAKGRDPKVEGERYRNAGWEAYQKRISAPH" gene complement(3379..4182) /gene="ura3" /label="ura3" /note="KlUra3" promoter 4498..4841 /label="TEF promoter" /note="Ashbya gossypii TEF promoter" CDS 4882..5396 /codon_start=1 /gene="kanMX4" /product="kanamycin resistance protein" /label="kanMX4" /note="KanR" /protein_id="AJD09820.1" /translation="MGKEKTHVSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGW" gene 4882..5396 /gene="kanMX4" /label="kanMX4" primer_bind complement(5417..5433) /label="KS primer" /note="common sequencing primer, one of multiple similar variants" promoter complement(5463..5481) /label="T3 promoter" /note="promoter for bacteriophage T3 RNA polymerase" primer_bind complement(5502..5518) /label="M13 rev" /note="common sequencing primer, one of multiple similar variants" protein_bind complement(5526..5542) /label="lac operator" /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(5550..5580) /label="lac promoter" /note="promoter for the E. coli lac operon" protein_bind complement(5595..5616) /label="CAP binding site" /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5904..6492) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6666..7523) /label="AmpR" /note="beta-lactamase" promoter complement(7524..7628) /label="AmpR promoter" misc_feature 7665..8168 /label="CEN/ARS" /note="S. cerevisiae CEN6 centromere fused to an autonomously replicating sequence"
This page is informational only.