Basic Vector Information
- Vector Name:
- pCON-R5R6
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5296 bp
- Type:
- Gateway recycling vector
- Replication origin:
- ori
- Source/Author:
- Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
pCON-R5R6 vector Vector Map
pCON-R5R6 vector Sequence
LOCUS 40924_12770 5296 bp DNA circular SYN 17-DEC-2018 DEFINITION Gateway recycling vector pCON-R5R6 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5296) AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T. TITLE Gateway Recycling Cloning System for Multigene Construction JOURNAL Published Only in Database (2012) REFERENCE 2 (bases 1 to 5296) AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 5296) TITLE Direct Submission REFERENCE 4 (bases 1 to 5296) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Published Only in Database (2012)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pDONR201. FEATURES Location/Qualifiers source 1..5296 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 28..127 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" protein_bind 683..806 /label=attR5 /note="recombination site for the Gateway(R) LR reaction" CDS complement(910..1566) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" misc_feature 2234..2257 /label=rare cutter sites /note="rare cutter sites" protein_bind complement(2524..2647) /label=attR6 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(3169..3268) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 3391..4197 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 4343..4931 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(5066..5093) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(5185..5271) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.