Basic Vector Information
- Vector Name:
- pCON-R5R6
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5296 bp
- Type:
- Gateway recycling vector
- Replication origin:
- ori
- Source/Author:
- Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
pCON-R5R6 vector Map
pCON-R5R6 vector Sequence
LOCUS 40924_12770 5296 bp DNA circular SYN 17-DEC-2018
DEFINITION Gateway recycling vector pCON-R5R6 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5296)
AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
TITLE Gateway Recycling Cloning System for Multigene Construction
JOURNAL Published Only in Database (2012)
REFERENCE 2 (bases 1 to 5296)
AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
TITLE Direct Submission
JOURNAL Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane
University, Center for Integrated Research in Science; 1060
Nishikawatsu, Matsue, Shimane 690-8504, Japan
REFERENCE 3 (bases 1 to 5296)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5296)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Published
Only in Database (2012)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center
for Integrated Research in Science; 1060 Nishikawatsu, Matsue,
Shimane 690-8504, Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT constructed using pDONR201.
FEATURES Location/Qualifiers
source 1..5296
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 28..127
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
protein_bind 683..806
/label=attR5
/note="recombination site for the Gateway(R) LR reaction"
CDS complement(910..1566)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
misc_feature 2234..2257
/label=rare cutter sites
/note="rare cutter sites"
protein_bind complement(2524..2647)
/label=attR6
/note="recombination site for the Gateway(R) LR reaction"
protein_bind complement(3169..3268)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
CDS 3391..4197
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 4343..4931
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(5066..5093)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(5185..5271)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.