Basic Vector Information
- Vector Name:
- pCON-Cm-rare1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4679 bp
- Type:
- Gateway conversion vector
- Replication origin:
- ori
- Source/Author:
- Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, Kawazu T, Nakagawa T.
pCON-Cm-rare1 vector Vector Map
pCON-Cm-rare1 vector Sequence
LOCUS 40924_12760 4679 bp DNA circular SYN 17-DEC-2018 DEFINITION Gateway conversion vector pCON-Cm-rare1 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4679) AUTHORS Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, Kawazu T, Nakagawa T. TITLE Development of the gateway recycling cloning system for multiple linking of expression cassettes in a defined order, and direction on gateway compatible binary vectors JOURNAL Biosci. Biotechnol. Biochem. 77 (2), 430-434 (2013) PUBMED 23391940 REFERENCE 2 (bases 1 to 4679) AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T. TITLE Direct Submission JOURNAL Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan REFERENCE 3 (bases 1 to 4679) TITLE Direct Submission REFERENCE 4 (bases 1 to 4679) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. Biotechnol. Biochem."; date: "2013"; volume: "77"; issue: "2"; pages: "430-434" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center for Integrated Research in Science; 1060 Nishikawatsu, Matsue, Shimane 690-8504, Japan" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT constructed using pDONR201. FEATURES Location/Qualifiers source 1..4679 /mol_type="other DNA" /organism="synthetic DNA construct" protein_bind 28..127 /label=attL1 /note="recombination site for the Gateway(R) LR reaction" primer_bind 652..668 /label=SK primer /note="common sequencing primer, one of multiple similar variants" protein_bind 676..800 /label=attR1 /note="recombination site for the Gateway(R) LR reaction" misc_feature 801..808 /label=rare cutter site /note="rare cutter site" promoter 825..855 /label=lac UV5 promoter /note="E. coli lac promoter with an 'up' mutation" CDS 909..1565 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" protein_bind complement(1927..2051) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" protein_bind complement(2552..2651) /label=attL2 /note="recombination site for the Gateway(R) LR reaction" CDS 2774..3580 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3726..4314 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" terminator complement(4449..4476) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(4568..4654) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene"
This page is informational only.