Basic Vector Information
- Vector Name:
- pCON-Cm-rare1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4679 bp
- Type:
- Gateway conversion vector
- Replication origin:
- ori
- Source/Author:
- Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, Kawazu T, Nakagawa T.
pCON-Cm-rare1 vector Map
pCON-Cm-rare1 vector Sequence
LOCUS 40924_12760 4679 bp DNA circular SYN 17-DEC-2018
DEFINITION Gateway conversion vector pCON-Cm-rare1 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4679)
AUTHORS Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K,
Kawazu T, Nakagawa T.
TITLE Development of the gateway recycling cloning system for multiple
linking of expression cassettes in a defined order, and direction on
gateway compatible binary vectors
JOURNAL Biosci. Biotechnol. Biochem. 77 (2), 430-434 (2013)
PUBMED 23391940
REFERENCE 2 (bases 1 to 4679)
AUTHORS Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
TITLE Direct Submission
JOURNAL Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane
University, Center for Integrated Research in Science; 1060
Nishikawatsu, Matsue, Shimane 690-8504, Japan
REFERENCE 3 (bases 1 to 4679)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4679)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biosci.
Biotechnol. Biochem."; date: "2013"; volume: "77"; issue: "2";
pages: "430-434"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center
for Integrated Research in Science; 1060 Nishikawatsu, Matsue,
Shimane 690-8504, Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT constructed using pDONR201.
FEATURES Location/Qualifiers
source 1..4679
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 28..127
/label=attL1
/note="recombination site for the Gateway(R) LR reaction"
primer_bind 652..668
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 676..800
/label=attR1
/note="recombination site for the Gateway(R) LR reaction"
misc_feature 801..808
/label=rare cutter site
/note="rare cutter site"
promoter 825..855
/label=lac UV5 promoter
/note="E. coli lac promoter with an 'up' mutation"
CDS 909..1565
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
protein_bind complement(1927..2051)
/label=attR2
/note="recombination site for the Gateway(R) LR reaction"
protein_bind complement(2552..2651)
/label=attL2
/note="recombination site for the Gateway(R) LR reaction"
CDS 2774..3580
/codon_start=1
/label=KanR
/note="aminoglycoside phosphotransferase"
/translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
rep_origin 3726..4314
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(4449..4476)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(4568..4654)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.