pCON vector (V008297)

LOCUS       40924_12755        4194 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Gateway conversion vector pCON DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4194)
  AUTHORS   Kimura T, Nakao A, Murata S, Kobayashi Y, Tanaka Y, Shibahara K, 
            Kawazu T, Nakagawa T.
  TITLE     Development of the gateway recycling cloning system for multiple 
            linking of expression cassettes in a defined order, and direction on
            gateway compatible binary vectors
  JOURNAL   Biosci. Biotechnol. Biochem. 77 (2), 430-434 (2013)
  PUBMED    23391940
REFERENCE   2  (bases 1 to 4194)
  AUTHORS   Kimura T, Shibahara K, Tanaka Y, Nakao A, Kawazu T, Nakagawa T.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane 
            University, Center for Integrated Research in Science; 1060 
            Nishikawatsu, Matsue, Shimane 690-8504, Japan
REFERENCE   3  (bases 1 to 4194)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4194)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biosci. 
            Biotechnol. Biochem."; date: "2013"; volume: "77"; issue: "2"; 
            pages: "430-434"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-OCT-2012) Contact:Tsuyoshi Nakagawa Shimane University, Center 
            for Integrated Research in Science; 1060 Nishikawatsu, Matsue, 
            Shimane 690-8504, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     constructed using pDONR201.
FEATURES             Location/Qualifiers
     source          1..4194
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    28..127
                     /label=attL1
                     /note="recombination site for the Gateway(R) LR reaction"
     primer_bind     652..668
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    676..800
                     /label=attR1
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        825..855
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an 'up' mutation"
     misc_feature    1127..1175
                     /label=rare cutter sites
                     /note="rare cutter sites"
     protein_bind    complement(1442..1566)
                     /label=attR2
                     /note="recombination site for the Gateway(R) LR reaction"
     protein_bind    complement(2067..2166)
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             2289..3095
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP
                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA
                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD
                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD
                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      3241..3829
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      complement(3964..3991)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(4083..4169)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"