Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V000428 | pHIV-H2BmRFP | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pHIV-H2BmRFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8045 bp
- Type:
- Mammalian Expression, Lentiviral
- Replication origin:
- ori
- Copy Number:
- High Copy
- Promoter:
- EF-1α
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- 5’-TGGAATTTGCCCTTTTTGAG-3’
- 3' Primer:
- 5’-AGGAACTGCTTCCTTCACGA-3’
pHIV-H2BmRFP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pHIV-H2BmRFP vector Sequence
LOCUS V000428 8045 bp DNA circular SYN 13-MAY-2021 DEFINITION Exported. ACCESSION V000428 VERSION V000428 KEYWORDS pHIV-H2BmRFP SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8045) AUTHORS Welm BE, Dijkgraaf GJ, Bledau AS, Welm AL, Werb Z TITLE Lentiviral transduction of mammary stem cells for analysis of gene function during development and cancer. JOURNAL Cell Stem Cell. 2008 Jan 10. 2(1):90-102. PUBMED 18371425 REFERENCE 2 (bases 1 to 8045) TITLE Direct Submission REFERENCE 3 (bases 1 to 8045) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Cell Stem Cell. 2008 Jan 10. 2(1):90-102." SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8045 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind complement(47..66) /label="pRS-marker" /note="pRS vectors, use to sequence yeast selectable marker" enhancer 238..617 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 618..820 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter" LTR 835..1015 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" misc_feature 1062..1187 /label="HIV-1 Psi" /note="packaging signal of human immunodeficiency virus type 1" misc_feature 1686..1919 /label="RRE" /note="The Rev response element (RRE) of HIV-1 allows for Rev-dependent mRNA export from the nucleus to the cytoplasm." CDS 2104..2148 /label="gp41 peptide" /note="antigenic peptide corresponding to amino acids 655 to 669 of the HIV envelope protein gp41 (Lutje Hulsik et al., 2013)" CDS 2297..2338 /note="Protein Tat from Human immunodeficiency virus type 1 group M subtype B (isolate WMJ22). Accession#: P12509" /label="Protein Tat" misc_feature 2446..2563 /label="cPPT/CTS" /note="central polypurine tract and central termination sequence of HIV-1" promoter 2627..3805 /label="EF-1-alpha promoter" /note="strong constitutive promoter for human elongation factor EF-1-alpha" misc_feature 3851..4437 /label="IRES2" /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 4438..4818 /codon_start=1 /gene="HIST1H2BJ" /product="human histone H2B" /label="H2B" /translation="MSPEPAKSAPAPKKGSKKAVTKAQKKGGKKRKRSRKESYSIYVYK VLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLL PGELAKHAVSEGTKAITKYTSAK" CDS 4837..5511 /label="mRFP1" /note="monomeric derivative of DsRed (Campbell et al., 2002)" primer_bind complement(5525..5541) /label="KS primer" /note="common sequencing primer, one of multiple similar variants" LTR 6051..6231 /label="5' LTR (truncated)" /note="truncated 5' long terminal repeat (LTR) from HIV-1" rep_origin complement(6293..6881) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(7055..7912) /label="AmpR" /note="beta-lactamase" promoter complement(7913..8017) /label="AmpR promoter"