pCN52 vector (V008334)

LOCUS       V008334                 6594 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008334
VERSION     V008334
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 6594)
  AUTHORS   Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
            King S, Hazbon MH.
  TITLE     Sequencing of a set of cassette-based shuttle vectors for
            Gram-positive bacteria deposited at BEI resources from the NARSA
            collection
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6594)
  AUTHORS   Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
            King S, Hazbon MH.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American
            Type and Culture Collection (ATCC), 10801 University Boulevard,
            Manassas, VA 20110-2209, USA
REFERENCE   3  (bases 1 to 6594)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6594)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: CLC Genomics Workbench v. 7.0.2
            Coverage              :: 70659
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and
            Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA
            20110-2209, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6594
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..2089
                     /note="pT181copwt repC; Staphylococcus replication
                     cassette; derived from J04764"
     misc_feature    159..392
                     /label="RS-B site"
                     /note="RS-B site"
     rep_origin      656..823
                     /note="ori; derived from Staphylococcus aureus"
     CDS             688..1632
                     /codon_start=1
                     /product="RepC protein"
                     /label="RepC protein"
                     /note="polypeptide A"
                     /protein_id="AMR43690.1"
                     /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF
                     DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD
                     RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK
                     KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV
                     DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP
                     VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK"
     variation       1132..1134
                     /label="E149D"
                     /note="E149D"
     misc_feature    1794..2089
                     /label="truncated polypeptide B"
                     /note="truncated polypeptide B"
     misc_feature    2408..2467
                     /label="leader peptide"
                     /note="leader peptide"
     CDS             2527..3258
                     /gene="ermC"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from
                     Staphylococcus aureus. Accession#: P02979"
     promoter        3626..3730
                     /label="AmpR promoter"
     CDS             3731..4588
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      4762..5350
                     /direction=RIGHT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     misc_feature    5487..5531
                     /note="polylinker; derived from M13mp19"
     CDS             5565..6278
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"
     misc_feature    6281..6290
                     /label="blaZTT"
                     /note="blaZTT"
     misc_feature    6453..6590
                     /label="TT"
                     /note="TT"