Basic Vector Information
- Vector Name:
- pCN47
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5845 bp
- Type:
- Staphylococcal shuttle vector
- Replication origin:
- ori
- Source/Author:
- Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH.
pCN47 vector Map
pCN47 vector Sequence
LOCUS V008337 5845 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V008337
VERSION V008337
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 5845)
AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
King S, Hazbon MH.
TITLE Sequencing of a set of cassette-based shuttle vectors for
Gram-positive bacteria deposited at BEI resources from the NARSA
collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5845)
AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R,
King S, Hazbon MH.
TITLE Direct Submission
JOURNAL Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American
Type and Culture Collection (ATCC), 10801 University Boulevard,
Manassas, VA 20110-2209, USA
REFERENCE 3 (bases 1 to 5845)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5845)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Assembly Method :: CLC Genomics Workbench v. 7.0.2
Coverage :: 80157
Sequencing Technology :: Illumina
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and
Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA
20110-2209, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5845
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..2089
/note="pT181copwt repC; Staphylococcus replication
cassette; derived from J04764"
misc_feature 159..392
/label="RS-B site"
/note="RS-B site"
rep_origin 656..823
/note="ori; derived from Staphylococcus aureus"
CDS 688..1632
/codon_start=1
/product="RepC protein"
/label="RepC protein"
/note="polypeptide A"
/protein_id="AMR43680.1"
/translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF
DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD
RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK
KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV
DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP
VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK"
variation 1132..1134
/label="E149D"
/note="E149D"
misc_feature 1794..2089
/label="truncated polypeptide B"
/note="truncated polypeptide B"
misc_feature 2408..2467
/label="leader peptide"
/note="leader peptide"
CDS 2527..3258
/gene="ermC"
/label="rRNA adenine N-6-methyltransferase"
/note="rRNA adenine N-6-methyltransferase from
Staphylococcus aureus. Accession#: P02979"
promoter 3626..3730
/label="AmpR promoter"
CDS 3731..4588
/label="AmpR"
/note="beta-lactamase"
rep_origin 4762..5350
/direction=RIGHT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature 5487..5531
/note="polylinker; derived from M13mp19"
misc_feature 5541..5841
/label="blaZ-TT"
/note="blaZ-TT"
misc_feature 5704..5841
/label="TT"
/note="TT"
This page is informational only.