Basic Vector Information
- Vector Name:
- pCN44
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8429 bp
- Type:
- Staphylococcal shuttle vector
- Replication origin:
- ori
- Source/Author:
- Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH.
pCN44 vector Map
pCN44 vector Sequence
LOCUS V008338 8429 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008338 VERSION V008338 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8429) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Sequencing of a set of cassette-based shuttle vectors for Gram-positive bacteria deposited at BEI resources from the NARSA collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 8429) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA REFERENCE 3 (bases 1 to 8429) TITLE Direct Submission REFERENCE 4 (bases 1 to 8429) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Coverage :: 25047 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8429 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..2089 /note="pT181copwt repC; Staphylococcus replication cassette; derived from J04764" misc_feature 159..392 /label="RS-B site" /note="RS-B site" rep_origin 656..823 /label="derived from Staphylococcus aureus" /note="derived from Staphylococcus aureus" CDS 688..1632 /codon_start=1 /product="RepC protein" /label="RepC protein" /note="polypeptide A" /protein_id="AMR43675.1" /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" variation 1132..1134 /label="E149D" /note="E149D" misc_feature 1794..2089 /label="truncated polypeptide B" /note="truncated polypeptide B" misc_feature 2408..2467 /label="leader peptide" /note="leader peptide" CDS 2527..3258 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" misc_feature 3364..4503 /note="phi11 EcoRI-K; derived from AF42478" misc_feature complement(3364..3483) /label="truncated RinA" /note="truncated RinA" CDS complement(3654..3842) /codon_start=1 /product="RinB" /label="RinB" /protein_id="AMR43677.1" /translation="MGCLVVVKEILRLLFLLAMYELGKYVTEQVYIMMTANDDVEAPSD FAKLSDQSDLMRAEVSE" CDS complement(4190..4363) /codon_start=1 /product="phi SLT ORF 81b-like protein" /label="phi SLT ORF 81b-like protein" /protein_id="AMR43676.1" /translation="MVLYKELDLFTCRIGMLLVLIVIVDFAKQKNMLATLSVVLILLFV EKLRIIQRSDKK" promoter 4758..4862 /label="AmpR promoter" CDS 4863..5720 /label="AmpR" /note="beta-lactamase" rep_origin 5894..6482 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 6834..7199 /gene="cadC" /label="Cadmium resistance transcriptional regulatory protein CadC" /note="Cadmium resistance transcriptional regulatory protein CadC from Staphylococcus aureus. Accession#: P20047" misc_feature 7205..7249 /note="polylinker; derived from M13mp19" CDS 7279..8121 /gene="blaZ" /label="Beta-lactamase" /note="Beta-lactamase from Staphylococcus aureus. Accession#: P00807" misc_feature 8288..8425 /label="TT" /note="TT"
This page is informational only.