Basic Vector Information
- Vector Name:
- pCN33
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5690 bp
- Type:
- Staphylococcal shuttle vector
- Replication origin:
- ori
- Source/Author:
- Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH.
pCN33 vector Map
pCN33 vector Sequence
LOCUS V008343 5690 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008343 VERSION V008343 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 5690) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Sequencing of a set of cassette-based shuttle vectors for Gram-positive bacteria deposited at BEI resources from the NARSA collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5690) AUTHORS Riojas MA, Bojja K, Byrd R, Hamid S, Mooney S, Monaco A, Alalade R, King S, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA REFERENCE 3 (bases 1 to 5690) TITLE Direct Submission REFERENCE 4 (bases 1 to 5690) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Coverage :: 53819 Sequencing Technology :: Illumina ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (14-MAY-2015) BEI Bacteriology, BEI Resources/American Type and Culture Collection (ATCC), 10801 University Boulevard, Manassas, VA 20110-2209, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5690 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..2089 /note="pT181copwt repC; Staphylococcus replication cassette; derived from J04764" misc_feature 159..392 /label="RS-B site" /note="RS-B site" rep_origin 656..823 /note="ori; derived from Staphylococcus aureus" CDS 688..1632 /codon_start=1 /product="RepC protein" /label="RepC protein" /note="polypeptide A" /protein_id="AMR43714.1" /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" variation 1132..1134 /label="E149D" /note="E149D" misc_feature 1794..2089 /label="truncated polypeptide B" /note="truncated polypeptide B" misc_feature 2408..2467 /label="leader peptide" /note="leader peptide" CDS 2527..3258 /gene="ermC" /label="rRNA adenine N-6-methyltransferase" /note="rRNA adenine N-6-methyltransferase from Staphylococcus aureus. Accession#: P02979" promoter 3626..3730 /label="AmpR promoter" CDS 3731..4588 /label="AmpR" /note="beta-lactamase" rep_origin 4762..5350 /direction=RIGHT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind complement(5532..5548) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants"
This page is informational only.