Basic Vector Information
- Vector Name:
- pCMH500
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8964 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Strive T, Hardy CM, French N, Wright JD, Nagaraja N, Reubel GH.
pCMH500 vector Map
pCMH500 vector Sequence
LOCUS 40924_11451 8964 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCMH500, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8964) AUTHORS Strive T, Hardy CM, French N, Wright JD, Nagaraja N, Reubel GH. TITLE Development of canine herpesvirus based antifertility vaccines for foxes using bacterial artificial chromosomes JOURNAL Vaccine 24 (7), 980-988 (2006) PUBMED 16198458 REFERENCE 2 (bases 1 to 8964) AUTHORS Hardy CM. TITLE Direct Submission JOURNAL Submitted (29-SEP-2004) Sustainable Ecosystems, CSIRO, GPO Box 284, Canberra, ACT 2601, Australia REFERENCE 3 (bases 1 to 8964) TITLE Direct Submission REFERENCE 4 (bases 1 to 8964) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Vaccine"; date: "2006"; volume: "24"; issue: "7"; pages: "980-988" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (29-SEP-2004) Sustainable Ecosystems, CSIRO, GPO Box 284, Canberra, ACT 2601, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8964 /mol_type="other DNA" /organism="synthetic DNA construct" source 1..6089 /isolate="greyhound" /mol_type="other DNA" /country="Australia" /db_xref="taxon:170325" /organism="Canid herpesvirus 1" misc_feature 1..1095 /label=similar to UL25 /note="similar to UL25" CDS complement(1153..1935) /codon_start=1 /product="UL24" /label=UL24 /protein_id="AAX18922.1" /translation="MKRNQRQTIRTRLCAGIRCHNRFYSVLTRDVKLASQNGIYSDRLS LLFGDLIPADILKRAGSVNLAFEVNLGQRRPDCVCTINLEHESMGLCILIELKTCRFSK NMNTASKTTQQRGGLKQLNDSVSLITKILPPGDGKVVLIPLLVFIAQRGMNILKVTSLP HKQLSSNIKTLAANLTKLAEYIPKPAKPVKGSNNRNKSLKQKVNCLKCNFVNCICIKTS NVEFINLTNTEKSTTCSNFESSTLLNPVKLISSLFNKD" misc_feature 1947..2460 /label=similar to UL23 thymidine kinase /note="similar to UL23 thymidine kinase" misc_feature 2268..2275 /note="NotI cloning site for insertion of transgenes; disrupts UL23 sequence" CDS 2570..4960 /codon_start=1 /product="UL22" /label=UL22 /note="glycoprotein H" /protein_id="AAX18923.1" /translation="MEVKYNFITFIFVIFFMLVFSNDLDNGEYKNLSLSNDFSYSSNVN ITTIENLFSYNNKFVFFFIFNKDSKRENGNLFLFPNFIFKSNKTENNYNIKSQPSEKQL TVFFNPYINLYLSSKYLIDFGVIPESSIQDWYFPRSIQTSTEQNPFGFILSPKRHVPNN GFFNKHKNLYKDGLLNDIMYVNLNSFSIPRKTYIPIYESTWPFDISLFESTLIQNENFC INITIGKEFMGMSITSSKYPPLEMITTPHDANVEMITRYKASMMLDPPGPSEGPLYKVF IIGYGTSKTDSNMYKIMQTIASYPEESLDYRYHLSMANFEVCFLLTYERKFLTNKMDME YFYKIFSRLSTALFSLSEMVRLSKYILNDEIIDIDFNINILTNIIVNHKMFKLSKQLIT SSQVNILLESSRENIVNNLNTFENYNLIFKNDELKIKYLKAVYTYLEIPTEKSLIISRD IINTLYNNSLYETIDWNVTSRKSLFLATSLLLLKTQNIVELRKIILQCTSMCTSDHAIS IEWSLENILNAKNNFKKQFSITDMFSPCMTSTRYDLIEDLHIVDLISVIPNNGNFKNLF SMGHKAASVVNSNILFGSNKIKMLIPELFICKIDINFKFLAILPLNNNNSYIITRKILN RGLTYNVNGIDIANPIFISYINSSNCLYSSVEILPLNLINPKNSKECLYCGSVIMRYLS SGVIIDLLYINDKEAETQLAAGVNSTIPSFNPLSYPVNLKTLLLFPNGTIVTINSITSH EQIKFSNTFIVISIVGIIITSFVVYGIFKMLCSFSYVKYSLLK" misc_feature 5003..5420 /label=GC-rich region /note="GC-rich region" misc_feature 5576..6089 /label=similar to UL21 /note="similar to UL21" promoter complement(6107..6125) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(6132..6148) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin complement(6289..6744) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 6771..6875 /label=AmpR promoter CDS 6876..7733 /label=AmpR /note="beta-lactamase" rep_origin 7907..8495 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 8783..8804 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 8819..8849 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 8857..8873 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 8881..8897 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 8918..8936 /label=T3 promoter /note="promoter for bacteriophage T3 RNA polymerase"
This page is informational only.