Basic Vector Information
- Vector Name:
- pCMF2E-mCASP-8
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7187 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- SV40
pCMF2E-mCASP-8 vector Vector Map
pCMF2E-mCASP-8 vector Sequence
LOCUS V008422 7187 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008422 VERSION V008422 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7187) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 7187) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 7187) TITLE Direct Submission REFERENCE 4 (bases 1 to 7187) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7187 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 13..54 /label="myr" /note="N-myristoylation signal from Src kinase (Pellman et al., 1985; Kaplan et al., 1988)" CDS 61..381 /label="FKBP" /note="human FK506-binding protein FKBP12" CDS 388..708 /codon_start=1 /note="unnamed protein product; hFKBP1A" /protein_id="SJL87495.1" /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL KLE" CDS 715..2151 /gene="Casp8" /label="Caspase-8" /note="Caspase-8 from Mus musculus. Accession#: O89110" CDS 2158..2184 /label="HA" /note="HA (human influenza hemagglutinin) epitope tag" intron 2216..2788 /label="beta-globin intron" /note="intron from rabbit beta-globin gene" CDS 2792..2914 /gene="HBB" /label="Hemoglobin subunit beta" /note="Hemoglobin subunit beta from Colobus guereza. Accession#: Q9TT33" polyA_signal 2985..3040 /label="beta-globin poly(A) signal" /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" rep_origin complement(3393..3528) /direction=LEFT /label="SV40 ori" /note="SV40 origin of replication" rep_origin complement(3805..4393) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(4564..5436) /codon_start=1 /note="unnamed protein product; ampicillin" /protein_id="SJL87497.1" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFQVEVAMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDL VEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTR LDRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAE IGASLIKHW" promoter complement(5437..5541) /label="AmpR promoter" rep_origin complement(5873..6328) /direction=LEFT /label="f1 ori" /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" primer_bind 6473..6489 /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" promoter 6496..6514 /label="T7 promoter" /note="promoter for bacteriophage T7 RNA polymerase" enhancer 6533..6836 /label="CMV enhancer" /note="human cytomegalovirus immediate early enhancer" promoter 6837..7040 /label="CMV promoter" /note="human cytomegalovirus (CMV) immediate early promoter"
This page is informational only.