Basic Vector Information
- Vector Name:
- pCM172
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8396 bp
- Type:
- Insertional expression vector
- Replication origin:
- ori
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM172 vector Map
pCM172 vector Sequence
LOCUS 40924_11341 8396 bp DNA circular SYN 17-DEC-2018 DEFINITION Insertional expression vector pCM172, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8396) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of an insertional expression vector system for Methylobacterium extorquens AM1 and generation of null mutants lacking mtdA and/or fch JOURNAL Microbiology (Reading, Engl.) 150 (PT 1), 9-19 (2004) PUBMED 14702393 REFERENCE 2 (bases 1 to 8396) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (22-MAY-2003) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 8396) TITLE Direct Submission REFERENCE 4 (bases 1 to 8396) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology (Reading, Engl.) 150 (PT 1), 9-19 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-MAY-2003) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8396 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 177..263 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 355..382 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" regulatory 457..774 /label=trrnB terminator from Escherichia coli /note="trrnB terminator from Escherichia coli" /regulatory_class="terminator" regulatory 457..774 /label=mxaF promoter /note="mxaF promoter" /regulatory_class="promoter" primer_bind 785..801 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" terminator 931..978 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 1205..1570 /codon_start=1 /gene="katA" /allele="'katA" /product="catalase" /label=katA /protein_id="AAP75630.1" /translation="DGAMRTDGNHGAQVDYEPNSFGGPKQDPSFSEPPLRIQGDAGRYG WPGDDEDLYGQPKLFWTKVLDEGGRKRLVENIVTSMGDSPRHIQERMIAHWFKVHEDFG RGVAQGLGIDTAQAAAE" gene 1205..1570 /gene="katA" /allele="'katA" /label=katA primer_bind complement(2371..2387) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2395..2411) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2419..2449) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2464..2485) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2773..3361) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3535..4392) /label=AmpR /note="beta-lactamase" promoter complement(4393..4497) /label=AmpR promoter CDS 4815..5712 /codon_start=1 /gene="katA" /allele="katA'" /product="catalase" /label=katA /protein_id="AAP75632.1" /translation="MQDYHLIEKMAHFNRERIPERVVHAKGYGAYGTFRLTRSLSEFTR AKVLTEVGKDVPMVARFSTVGGESGSADTARDPRGFALKFYTEEGNWDLVGNNTPIFFV RDAIKFSDFIRTQKRDPRTHLKPHWRRWDFWSLSPEAIHQVMFLYSDRGTPKSARFMNG YGSHTFSLWNDRGERHWVKFHFHTKQGIQNFSADEADEVAGKDPDYSSADLSTAIEQGD FPKWKVSVQLMPELDADTYRINPFDLTKVWPHGDYPLIEIGEMELNRNPENYFAEIEQS AFEPSNVVPGIGFSPHKM" gene 4815..5712 /gene="katA" /allele="katA'" /label=katA misc_recomb 5729..5762 /note="loxP; Cre-recombinase recognition site" protein_bind 5729..5762 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." CDS complement(6118..6765) /label=TetR /note="tetracycline resistance regulatory protein" CDS 6871..8067 /label=TcR /note="tetracycline efflux protein" protein_bind complement(8088..8121) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(8135..8151) /label=KS primer /note="common sequencing primer, one of multiple similar variants" primer_bind 8375..8391 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.