Basic Vector Information
- Vector Name:
- pCM168
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8074 bp
- Type:
- Insertional cloning vector
- Replication origin:
- ori
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM168 vector Map
pCM168 vector Sequence
LOCUS 40924_11336 8074 bp DNA circular SYN 17-DEC-2018 DEFINITION Insertional cloning vector pCM168, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8074) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of an insertional expression vector system for Methylobacterium extorquens AM1 and generation of null mutants lacking mtdA and/or fch JOURNAL Microbiology (Reading, Engl.) 150 (PT 1), 9-19 (2004) PUBMED 14702393 REFERENCE 2 (bases 1 to 8074) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (22-MAY-2003) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 8074) TITLE Direct Submission REFERENCE 4 (bases 1 to 8074) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology (Reading, Engl.) 150 (PT 1), 9-19 (2004)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-MAY-2003) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8074 /mol_type="other DNA" /organism="synthetic DNA construct" terminator 177..263 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 355..382 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator 609..656 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" CDS 883..1248 /codon_start=1 /gene="katA" /allele="'katA" /product="catalase" /label=katA /protein_id="AAP75625.1" /translation="DGAMRTDGNHGAQVDYEPNSFGGPKQDPSFSEPPLRIQGDAGRYG WPGDDEDLYGQPKLFWTKVLDEGGRKRLVENIVTSMGDSPRHIQERMIAHWFKVHEDFG RGVAQGLGIDTAQAAAE" gene 883..1248 /gene="katA" /allele="'katA" /label=katA primer_bind complement(2049..2065) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2073..2089) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2097..2127) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2142..2163) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(2451..3039) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3213..4070) /label=AmpR /note="beta-lactamase" promoter complement(4071..4175) /label=AmpR promoter CDS 4493..5390 /codon_start=1 /gene="katA" /allele="katA'" /product="catalase" /label=katA /protein_id="AAP75627.1" /translation="MQDYHLIEKMAHFNRERIPERVVHAKGYGAYGTFRLTRSLSEFTR AKVLTEVGKDVPMVARFSTVGGESGSADTARDPRGFALKFYTEEGNWDLVGNNTPIFFV RDAIKFSDFIRTQKRDPRTHLKPHWRRWDFWSLSPEAIHQVMFLYSDRGTPKSARFMNG YGSHTFSLWNDRGERHWVKFHFHTKQGIQNFSADEADEVAGKDPDYSSADLSTAIEQGD FPKWKVSVQLMPELDADTYRINPFDLTKVWPHGDYPLIEIGEMELNRNPENYFAEIEQS AFEPSNVVPGIGFSPHKM" gene 4493..5390 /gene="katA" /allele="katA'" /label=katA misc_recomb 5407..5440 /note="loxP; Cre-recombinase recognition site" protein_bind 5407..5440 /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)." CDS complement(5796..6443) /label=TetR /note="tetracycline resistance regulatory protein" CDS 6549..7745 /label=TcR /note="tetracycline efflux protein" protein_bind complement(7766..7799) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." primer_bind complement(7813..7829) /label=KS primer /note="common sequencing primer, one of multiple similar variants" primer_bind 8053..8069 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.