Basic Vector Information
- Vector Name:
- pCM160
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7974 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM160 vector Vector Map
pCM160 vector Sequence
LOCUS 40924_11331 7974 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCM160, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7974) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of improved versatile broad-host-range vectors for use in methylotrophs and other Gram-negative bacteria JOURNAL Microbiology 147 (Pt 8), 2065-2075 (2001) PUBMED 11495985 REFERENCE 2 (bases 1 to 7974) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 7974) TITLE Direct Submission REFERENCE 4 (bases 1 to 7974) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology 147 (Pt 8), 2065-2075 (2001)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7974 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 3..712 /label=oriV /note="incP origin of replication" rep_origin 1105..1693 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 1981..2002 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2017..2047 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 2055..2071 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 2079..2095 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" regulatory 2118..2435 /note="PmxaF; Methylobacterium extorquens mxa operon promoter" /regulatory_class="promoter" primer_bind 2446..2462 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature complement(2475..2531) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(2532..2548) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(2993..3634) /label=TetR /note="tetracycline resistance regulatory protein" CDS complement(4415..5227) /label=KanR /note="aminoglycoside phosphotransferase" CDS complement(5902..7047) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(7319..7690) /codon_start=1 /gene="traJ" /product="oriT-recognizing protein" /label=traJ /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" CDS complement(7574..7690) /codon_start=1 /gene="traJ'" /product="TraJ'" /label=traJ' /note="truncated oriT-recognizing protein" /protein_id="AAK73413.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL" gene complement(7574..7690) /gene="traJ'" /label=traJ' oriT complement(7723..7832) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.