Basic Vector Information
- Vector Name:
- pCM130
- Antibiotic Resistance:
- Tetracycline
- Length:
- 7965 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM130 vector Map
pCM130 vector Sequence
LOCUS V008444 7965 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V008444 VERSION V008444 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 7965) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of improved versatile broad-host-range vectors for use in methylotrophs and other Gram-negative bacteria JOURNAL Microbiology 147 (Pt 8), 2065-2075 (2001) PUBMED 11495985 REFERENCE 2 (bases 1 to 7965) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 7965) TITLE Direct Submission REFERENCE 4 (bases 1 to 7965) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology 147 (Pt 8), 2065-2075 (2001)" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7965 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 3..712 /label="oriV" /note="incP origin of replication" rep_origin 1105..1693 /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(1773..2693) /gene="xylE" /label="Metapyrocatechase" /note="Metapyrocatechase from Pseudomonas putida. Accession#: P06622" misc_feature complement(2708..2763) /label="MCS" /note="pUC18/19 multiple cloning site" terminator complement(2865..2892) /label="rrnB T2 terminator" /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(2984..3070) /label="rrnB T1 terminator" /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind complement(3252..3268) /label="M13 fwd" /note="common sequencing primer, one of multiple similar variants" CDS complement(3713..4354) /label="TetR" /note="tetracycline resistance regulatory protein" CDS 4460..5656 /label="TcR" /note="tetracycline efflux protein" CDS complement(5893..7038) /label="trfA" /note="trans-acting replication protein that binds to and activates oriV" CDS complement(7310..7681) /codon_start=1 /gene="traJ" /product="oriT-recognizing protein" /label="traJ" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" CDS complement(7565..7681) /codon_start=1 /gene="traJ'" /product="TraJ'" /label="traJ'" /note="truncated oriT-recognizing protein" /protein_id="AAK73422.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL" gene complement(7565..7681) /gene="traJ'" /label="traJ'" oriT complement(7714..7823) /direction=LEFT /label="oriT" /note="incP origin of transfer"
This page is informational only.