Basic Vector Information
- Vector Name:
- pCM110
- Antibiotic Resistance:
- Tetracycline
- Length:
- 5834 bp
- Type:
- Cloning vector
- Replication origin:
- oriV
- Source/Author:
- Marx CJ, Lidstrom ME.
pCM110 vector Vector Map
pCM110 vector Sequence
LOCUS 40924_11316 5834 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCM110, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5834) AUTHORS Marx CJ, Lidstrom ME. TITLE Development of improved versatile broad-host-range vectors for use in methylotrophs and other Gram-negative bacteria JOURNAL Microbiology 147 (Pt 8), 2065-2075 (2001) PUBMED 11495985 REFERENCE 2 (bases 1 to 5834) AUTHORS Marx CJ, Lidstrom ME. TITLE Direct Submission JOURNAL Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA REFERENCE 3 (bases 1 to 5834) TITLE Direct Submission REFERENCE 4 (bases 1 to 5834) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microbiology 147 (Pt 8), 2065-2075 (2001)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (12-DEC-2000) Microbiology, University of Washington, Box 357242, Seattle, WA 98195, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5834 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin 3..712 /label=oriV /note="incP origin of replication" RBS 820..828 /label=Shine-Dalgarno sequence /note="full consensus sequence for ribosome-binding sites upstream of start codons in E. coli; complementary to a region in the 3' end of the 16S rRNA (Chen et al., 1994)" regulatory 856..1195 /note="PmxaF; Methylobacterium extorquens mxa operon promoter" /regulatory_class="promoter" CDS complement(1576..2223) /label=TetR /note="tetracycline resistance regulatory protein" CDS 2329..3525 /label=TcR /note="tetracycline efflux protein" CDS complement(3762..4907) /label=trfA /note="trans-acting replication protein that binds to and activates oriV" CDS complement(5179..5550) /codon_start=1 /gene="traJ" /product="oriT-recognizing protein" /label=traJ /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL*AYLLAV GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE KQDELGKVMMGVVRPRAEP" CDS complement(5434..5550) /codon_start=1 /gene="traJ'" /product="TraJ'" /label=traJ' /note="truncated oriT-recognizing protein" /protein_id="AAK73417.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSL" gene complement(5434..5550) /gene="traJ'" /label=traJ' oriT complement(5583..5692) /direction=LEFT /label=oriT /note="incP origin of transfer"
This page is informational only.