Basic Vector Information
- Vector Name:
- pCHR8
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 7564 bp
- Type:
- Cloning vector
- Replication origin:
- ori2
- Source/Author:
- Miyazaki C, Saito A.
pCHR8 vector Vector Map
pCHR8 vector Sequence
LOCUS 40924_10686 7564 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pCHR8 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7564) AUTHORS Miyazaki C, Saito A. TITLE Construction of a rice bacterial artificial chromosome library using a new vector suitable for map-based cloning and identification of clones linked to lethal factor locus in rice chromosome 3 JOURNAL Unpublished REFERENCE 2 (bases 1 to 7564) AUTHORS Miyazaki C. TITLE Direct Submission JOURNAL Submitted (16-JUN-1998) Contact:Chikara Miyazaki Kyushu National Agricultural Experiment Station, Department of Crop Breeding; 2421 Suya, Nishigoshi, Kumamoto 861-1192, Japan REFERENCE 3 (bases 1 to 7564) TITLE Direct Submission REFERENCE 4 (bases 1 to 7564) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-JUN-1998) Contact:Chikara Miyazaki Kyushu National Agricultural Experiment Station, Department of Crop Breeding; 2421 Suya, Nishigoshi, Kumamoto 861-1192, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7564 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 289..305 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" promoter 312..330 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 333..440 /label=multicloning site from EcoRI to MluI /note="multicloning site from EcoRI to MluI" promoter complement(453..471) /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" primer_bind complement(489..505) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(513..529) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(537..567) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(582..603) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(826..1482) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(1483..1585) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin 2512..2731 /label=ori2 /note="secondary origin of replication for the bacterial F plasmid; also known as oriS" CDS 2822..3574 /codon_start=1 /label=repE /note="replication initiation protein for the bacterial F plasmid" /translation="MAETAVINHKKRKNSPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQ IRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEASKDIRQALKSFAGKEVVFYRPEEDAG DEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFFIGLQNRFTQFRLSETKEITNPYAM RLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQRMPDFRRRFLQVCVNEINSRTPM RLSYIEKKKGRQTTHIVFSFRDITSMTTG" misc_feature 3580..3830 /label=incC /note="incompatibility region of the bacterial F plasmid" CDS 4156..5328 /codon_start=1 /label=sopA /note="partitioning protein for the bacterial F plasmid" /translation="MFRMKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRI GEAADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRA EDVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPTD PHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQFF DMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRETDE VGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR" CDS 5331..6299 /codon_start=1 /label=sopB /note="partitioning protein for the bacterial F plasmid" /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGNA ITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTP AFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYER GQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGD ALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQF APGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP" misc_feature 6375..6848 /label=sopC /note="centromere-like partitioning region of the bacterial F plasmid" misc_feature complement(7108..7506) /label=cos /note="lambda cos site; allows packaging into phage lambda particles" protein_bind complement(7524..7557) /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.