Basic Vector Information
- Vector Name:
- pCGL0609
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6398 bp
- Type:
- Shuttle vector
- Replication origin:
- ColA ori
- Source/Author:
- Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
pCGL0609 vector Map
pCGL0609 vector Sequence
LOCUS 40924_10581 6398 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pCGL0609, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6398) AUTHORS Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G. TITLE 'Integron'-bearing vectors: a method suitable for stable chromosomal integration in highly restrictive corynebacteria JOURNAL Gene 107 (1), 61-68 (1991) PUBMED 1660430 REFERENCE 2 (bases 1 to 6398) AUTHORS Ankri S, Reyes O, Leblon G. TITLE Electrotransformation of highly DNA-restrictive corynebacteria with synthetic DNA JOURNAL Plasmid 35 (1), 62-66 (1996) PUBMED 8693028 REFERENCE 3 (bases 1 to 6398) AUTHORS Ben-Samoun K, Leblon G, Reyes O. TITLE Positively regulated expression of the Escherichia coli araBAD promoter in Corynebacterium glutamicum JOURNAL FEMS Microbiol. Lett. 174 (1), 125-130 (1999) PUBMED 10234830 REFERENCE 4 (bases 1 to 6398) AUTHORS Ben-Samoun K, Leblon G, Reyes O. TITLE Direct Submission JOURNAL Submitted (17-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie URA 2225, Universite de Paris XI, Orsay F-91405, France REFERENCE 5 (bases 1 to 6398) TITLE Direct Submission REFERENCE 6 (bases 1 to 6398) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1991"; volume: "107"; issue: "1"; pages: "61-68" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; date: "1996"; volume: "35"; issue: "1"; pages: "62-66" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "FEMS Microbiol. Lett."; date: "1999"; volume: "174"; issue: "1"; pages: "125-130" COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Submitted (17-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie URA 2225, Universite de Paris XI, Orsay F-91405, France" COMMENT SGRef: number: 5; type: "Journal Article" FEATURES Location/Qualifiers source 1..6398 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 72..88 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS 675..1466 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF" gene complement(2411..3799) /gene="repBl1" /label=repBl1 CDS complement(2495..3700) /codon_start=1 /gene="repBl1" /product="replicase" /label=repBl1 /note="minimally known pBl1 region able to promote replication" /protein_id="AAD08692.1" /translation="MYKITNSKALAGCHRWRRDEAVAVSWSSNGASQFEGLQNSHSRWG SPLAELEVMGERRIELAIATKNHLAAGGALMMFVGTVRHNRSQSFAQVEAGIKTAYSSM VKTSQWKKERARYGVEHTYSDYEVTDSWANGWHLHRNMLLFLDRPLSDDELKAFEDSMF SRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDAAKMATYLAKGMSQELTGSATKTASKG SYTPFQMLDMLADQSDAGEDMDAVLVARWREYEVGSKNLRSSWSRGAKRALGIDYIDAD VRREMEEELYKLAGLEAPERVESTRVAVALVKPDDWKLIQSDFAVRQYVLDCVDKAKDV AAAQRVANEVLASLGVDSTPCMIVMDDVDLDAVLPTHGDATKRDLNAAVFAGNEQTILR TH" rep_origin complement(5287..5821) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." rep_origin 5889..6317 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.