Basic Vector Information
- Vector Name:
- pCGL0482
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6241 bp
- Type:
- Shuttle vector
- Replication origin:
- ColA ori
- Source/Author:
- Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
pCGL0482 vector Map
pCGL0482 vector Sequence
LOCUS 40924_10576 6241 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pCGL0482, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6241) AUTHORS Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G. TITLE 'Integron'-bearing vectors: a method suitable for stable chromosomal integration in highly restrictive corynebacteria JOURNAL Gene 107 (1), 61-68 (1991) PUBMED 1660430 REFERENCE 2 (bases 1 to 6241) AUTHORS Ankri S, Reyes O, Leblon G. TITLE Direct Submission JOURNAL Submitted (16-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie URA 2225, Universite de Paris XI, Orsay F-91405 Orsay cedex, France REFERENCE 3 (bases 1 to 6241) TITLE Direct Submission REFERENCE 4 (bases 1 to 6241) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1991"; volume: "107"; issue: "1"; pages: "61-68" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie URA 2225, Universite de Paris XI, Orsay F-91405 Orsay cedex, France" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6241 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 72..88 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS complement(450..1106) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(1107..1209) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" CDS complement(2338..3543) /codon_start=1 /gene="repBl1" /product="replicase" /label=repBl1 /note="minimally known pBl1 region able to promote replication" /protein_id="AAD08689.1" /translation="MYKITNSKALAGCHRWRRDEAVAVSWSSNGASQFEGLQNSHSRWG SPLAELEVMGERRIELAIATKNHLAAGGALMMFVGTVRHNRSQSFAQVEAGIKTAYSSM VKTSQWKKERARYGVEHTYSDYEVTDSWANGWHLHRNMLLFLDRPLSDDELKAFEDSMF SRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDAAKMATYLAKGMSQELTGSATKTASKG SYTPFQMLDMLADQSDAGEDMDAVLVARWREYEVGSKNLRSSWSRGAKRALGIDYIDAD VRREMEEELYKLAGLEAPERVESTRVAVALVKPDDWKLIQSDFAVRQYVLDCVDKAKDV AAAQRVANEVLASLGVDSTPCMIVMDDVDLDAVLPTHGDATKRDLNAAVFAGNEQTILR TH" gene complement(2338..3543) /gene="repBl1" /label=repBl1 rep_origin complement(5130..5664) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." rep_origin 5732..6160 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.