pCGL0243 vector (V008542)

LOCUS       40924_10571        6272 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Shuttle vector pCGL0243, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6272)
  AUTHORS   Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
  TITLE     'Integron'-bearing vectors: a method suitable for stable chromosomal
            integration in highly restrictive corynebacteria
  JOURNAL   Gene 107 (1), 61-68 (1991)
  PUBMED    1660430
REFERENCE   2  (bases 1 to 6272)
  AUTHORS   Ankri S, Reyes O, Leblon G.
  TITLE     Electrotransformation of highly DNA-restrictive corynebacteria with 
            synthetic DNA
  JOURNAL   Plasmid 35 (1), 62-66 (1996)
  PUBMED    8693028
REFERENCE   3  (bases 1 to 6272)
  AUTHORS   Ankri S, Bouvier I, Reyes O, Predali F, Leblon G.
  TITLE     A Brevibacterium linens pRBL1 replicon functional in Corynebacterium
            glutamicum
  JOURNAL   Plasmid 36 (1), 36-41 (1996)
  PUBMED    8938050
REFERENCE   4  (bases 1 to 6272)
  AUTHORS   Reyes O.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-1998) Laboratoire de Biologie Moleculaire des 
            Corynebacteries, Institut de Genetique et Microbiologie, Universite 
            de Paris-Sud, Orsay 91405, France
REFERENCE   5  (bases 1 to 6272)
  TITLE     Direct Submission
REFERENCE   6  (bases 1 to 6272)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; 
            date: "1991"; volume: "107"; issue: "1"; pages: "61-68"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; 
            date: "1996"; volume: "35"; issue: "1"; pages: "62-66"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Plasmid"; 
            date: "1996"; volume: "36"; issue: "1"; pages: "36-41"
COMMENT     SGRef: number: 4; type: "Journal Article"; journalName: "Submitted 
            (09-SEP-1998) Laboratoire de Biologie Moleculaire des 
            Corynebacteries, Institut de Genetique et Microbiologie, Universite 
            de Paris-Sud, Orsay 91405, France"
COMMENT     SGRef: number: 5; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6272
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     72..88
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(175..966)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    1624..1920
                     /note="partial sequence of pACYC184 Tn9 (cat) gene from
                     GenBank Accession Number X06403; chloramphenicol sensitive;
                     BclI-ScaI fragment"
     misc_feature    1921..4829
                     /note="cryptic plasmid pBL1 (ATCC accession 21086)
                     replication region; similar to Brevibacterium 
                     lactofermentum plasmid in GenBank Accession Number X03987 
                     (ATCC accession 13869)"
     CDS             complement(2369..3652)
                     /codon_start=1
                     /product="replicase"
                     /label=replicase
                     /protein_id="AAD03697.1"
                     /translation="MNTSKEPQVNEGSKVTRARAWRRQNVMYKITNSKALAGCHRWRRD
                     EAVAVSWSSNGASQFEGLQNSHSRWGSPLAELEVMGERRIELAIATKNHLAAGGALMMF
                     VGTVRHNRSQSFAQVEAGIKTAYSSMVKTSQWKKERARYGVEHTYSDYEVTDSWANGWH
                     LHRNMLLFLDRPLSDDELKAFEDSMFSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDA
                     AKMATYLAKGMSQELTGSATKTASKGSYTPFQMLDMLADQSDAGEDMDAVLVARWREYE
                     VGSKNLRSSWSRGAKRALGIDYIDADVRREMEEELYKLAGLEAPERVESTRVAVALVKP
                     DDWKLIQSDFAVRQYVLDCVDKAKDVAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAV
                     LPTHGDATKRDLNAAVFAGNEQTILRTH"
     rep_origin      complement(5161..5695)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     rep_origin      5763..6191
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"