Basic Vector Information
- Vector Name:
- pCGL0243
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6272 bp
- Type:
- Shuttle vector
- Replication origin:
- ColA ori
- Source/Author:
- Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
pCGL0243 vector Vector Map
pCGL0243 vector Sequence
LOCUS 40924_10571 6272 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pCGL0243, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6272) AUTHORS Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G. TITLE 'Integron'-bearing vectors: a method suitable for stable chromosomal integration in highly restrictive corynebacteria JOURNAL Gene 107 (1), 61-68 (1991) PUBMED 1660430 REFERENCE 2 (bases 1 to 6272) AUTHORS Ankri S, Reyes O, Leblon G. TITLE Electrotransformation of highly DNA-restrictive corynebacteria with synthetic DNA JOURNAL Plasmid 35 (1), 62-66 (1996) PUBMED 8693028 REFERENCE 3 (bases 1 to 6272) AUTHORS Ankri S, Bouvier I, Reyes O, Predali F, Leblon G. TITLE A Brevibacterium linens pRBL1 replicon functional in Corynebacterium glutamicum JOURNAL Plasmid 36 (1), 36-41 (1996) PUBMED 8938050 REFERENCE 4 (bases 1 to 6272) AUTHORS Reyes O. TITLE Direct Submission JOURNAL Submitted (09-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie, Universite de Paris-Sud, Orsay 91405, France REFERENCE 5 (bases 1 to 6272) TITLE Direct Submission REFERENCE 6 (bases 1 to 6272) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene"; date: "1991"; volume: "107"; issue: "1"; pages: "61-68" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid"; date: "1996"; volume: "35"; issue: "1"; pages: "62-66" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Plasmid"; date: "1996"; volume: "36"; issue: "1"; pages: "36-41" COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Submitted (09-SEP-1998) Laboratoire de Biologie Moleculaire des Corynebacteries, Institut de Genetique et Microbiologie, Universite de Paris-Sud, Orsay 91405, France" COMMENT SGRef: number: 5; type: "Journal Article" FEATURES Location/Qualifiers source 1..6272 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 72..88 /label=SK primer /note="common sequencing primer, one of multiple similar variants" CDS complement(175..966) /label=KanR /note="aminoglycoside phosphotransferase" misc_feature 1624..1920 /note="partial sequence of pACYC184 Tn9 (cat) gene from GenBank Accession Number X06403; chloramphenicol sensitive; BclI-ScaI fragment" misc_feature 1921..4829 /note="cryptic plasmid pBL1 (ATCC accession 21086) replication region; similar to Brevibacterium lactofermentum plasmid in GenBank Accession Number X03987 (ATCC accession 13869)" CDS complement(2369..3652) /codon_start=1 /product="replicase" /label=replicase /protein_id="AAD03697.1" /translation="MNTSKEPQVNEGSKVTRARAWRRQNVMYKITNSKALAGCHRWRRD EAVAVSWSSNGASQFEGLQNSHSRWGSPLAELEVMGERRIELAIATKNHLAAGGALMMF VGTVRHNRSQSFAQVEAGIKTAYSSMVKTSQWKKERARYGVEHTYSDYEVTDSWANGWH LHRNMLLFLDRPLSDDELKAFEDSMFSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDA AKMATYLAKGMSQELTGSATKTASKGSYTPFQMLDMLADQSDAGEDMDAVLVARWREYE VGSKNLRSSWSRGAKRALGIDYIDADVRREMEEELYKLAGLEAPERVESTRVAVALVKP DDWKLIQSDFAVRQYVLDCVDKAKDVAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAV LPTHGDATKRDLNAAVFAGNEQTILRTH" rep_origin complement(5161..5695) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." rep_origin 5763..6191 /direction=RIGHT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.