pCEV-G4-Ph vector (V008562)

Basic Vector Information

Vector Name:
pCEV-G4-Ph
Antibiotic Resistance:
Ampicillin
Length:
6151 bp
Type:
Cloning and expression vector
Replication origin:
ori
Host:
Yeast
Source/Author:
Vickers CE, Bydder SF, Zhou Y, Nielsen LK.
Promoter:
TEF1

pCEV-G4-Ph vector Map

pCEV-G4-Ph6151 bp30060090012001500180021002400270030003300360039004200450048005100540057006000ADH1 terminatorFLAGHXT7 promoter from Saccharomyces cerevisiaeTEF1 promoterT7 promoterMycCYC1 terminatororiAmpRAmpR promoter2u oriloxPTEF promoterbleTEF terminatorloxP recognition sequence for Cre recombinase

pCEV-G4-Ph vector Sequence

LOCUS       40924_10441        6151 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning and expression vector pCEV-G4-Ph, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6151)
  AUTHORS   Vickers CE, Bydder SF, Zhou Y, Nielsen LK.
  TITLE     Dual gene expression cassette vectors with antibiotic selection 
            markers for engineering in Saccharomyces cerevisiae
  JOURNAL   Microb. Cell Fact. 12 (1), 96 (2013)
  PUBMED    24161108
REFERENCE   2  (bases 1 to 6151)
  AUTHORS   Bydder SF, Vickers CE.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JUL-2013) AIBN, The University of Queensland, Crn 
            College and Cooper Roads (Bldg 75), St Lucia, QLD 4072, Australia
REFERENCE   3  (bases 1 to 6151)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6151)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Microb. 
            Cell Fact."; date: "2013"; volume: "12"; issue: "1"; pages: "96"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-JUL-2013) AIBN, The University of Queensland, Crn College and 
            Cooper Roads (Bldg 75), St Lucia, QLD 4072, Australia"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6151
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     terminator      complement(2..167)
                     /label=ADH1 terminator
                     /note="transcription terminator for the S. cerevisiae
                     alcohol dehydrogenase 1 (ADH1) gene"
     CDS             complement(315..338)
                     /label=FLAG
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     regulatory      complement(352..937)
                     /label=HXT7 promoter from Saccharomyces cerevisiae
                     /note="HXT7 promoter from Saccharomyces cerevisiae"
                     /regulatory_class="promoter"
     promoter        946..1353
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        1373..1391
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1409..1438
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
     terminator      1468..1657
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(1900..2488)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2662..3519)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(3520..3624)
                     /label=AmpR promoter
     rep_origin      complement(3651..4993)
                     /direction=LEFT
                     /label=2u ori
                     /note="yeast 2u plasmid origin of replication"
     protein_bind    5013..5046
                     /label=loxP
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (ATGTATGC) (Shaw et al., 2021)."
     promoter        5101..5444
                     /label=TEF promoter
                     /note="Ashbya gossypii TEF promoter"
     CDS             5445..5831
                     /codon_start=1
                     /gene="ble"
                     /product="bleomycin resistance protein"
                     /label=ble
                     /protein_id="AGZ03679.1"
                     /translation="MGMTDQATPNLPSRDFDPTAAFYERLGFGIVFRDAGWMILQRGDL
                     MLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGT
                     MAALVDPDGTLLRLIQNELLAGIS"
     gene            5445..5831
                     /gene="ble"
                     /label=ble
     terminator      5837..6034
                     /label=TEF terminator
                     /note="Ashbya gossypii TEF terminator"
     misc_recomb     6097..6130
                     /label=loxP recognition sequence for Cre recombinase
                     /note="loxP recognition sequence for Cre recombinase"
     protein_bind    complement(6097..6130)
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."

This page is informational only.