Basic Vector Information
- Vector Name:
- pCEV-G2-Ph
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6558 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Behrendorff JB, Vickers CE, Chrysanthopoulos P, Nielsen LK.
- Promoter:
- TEF1
pCEV-G2-Ph vector Vector Map
pCEV-G2-Ph vector Sequence
LOCUS 40924_10421 6558 bp DNA circular SYN 17-DEC-2018 DEFINITION Expression vector pCEV-G2-Ph, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6558) AUTHORS Behrendorff JB, Vickers CE, Chrysanthopoulos P, Nielsen LK. TITLE 2,2-Diphenyl-1-picrylhydrazyl as a screening tool for recombinant monoterpene biosynthesis JOURNAL Microb. Cell Fact. 12 (1), 76 (2013) PUBMED 23968454 REFERENCE 2 (bases 1 to 6558) AUTHORS Vickers CE. TITLE Direct Submission JOURNAL Submitted (28-MAY-2013) Australian Institute for Bioengineering and Nanotechnology, The University of Queensland, Cnr College and Cooper Rds, St Lucia, QLD 4072, Australia REFERENCE 3 (bases 1 to 6558) TITLE Direct Submission REFERENCE 4 (bases 1 to 6558) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Microb. Cell Fact."; date: "2013"; volume: "12"; issue: "1"; pages: "76" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (28-MAY-2013) Australian Institute for Bioengineering and Nanotechnology, The University of Queensland, Cnr College and Cooper Rds, St Lucia, QLD 4072, Australia" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6558 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(2..167) /label=ADH1 terminator /note="transcription terminator for the S. cerevisiae alcohol dehydrogenase 1 (ADH1) gene" CDS complement(315..338) /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" regulatory complement(360..1343) /label=Saccharomyces cerevisiae PGK1 promoter /note="Saccharomyces cerevisiae PGK1 promoter" /regulatory_class="promoter" promoter 1353..1760 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 1780..1798 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1816..1845 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" terminator 1875..2064 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(2307..2895) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3069..3926) /label=AmpR /note="beta-lactamase" promoter complement(3927..4031) /label=AmpR promoter rep_origin complement(4058..5400) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication" protein_bind 5420..5453 /label=loxP /note="Cre-mediated recombination occurs in the 8-bp core sequence (ATGTATGC) (Shaw et al., 2021)." promoter 5508..5851 /label=TEF promoter /note="Ashbya gossypii TEF promoter" CDS 5852..6238 /codon_start=1 /gene="ble" /product="bleomycin resistance protein" /label=ble /protein_id="AGV68806.1" /translation="MGMTDQATPNLPSRDFDPTAAFYERLGFGIVFRDAGWMILQRGDL MLEFFAHPGLDPLASWFSCCLRLDDLAEFYRQCKSVGIQETSSGYPRIHAPELQEWGGT MAALVDPDGTLLRLIQNELLAGIS" gene 5852..6238 /gene="ble" /label=ble terminator 6244..6441 /label=TEF terminator /note="Ashbya gossypii TEF terminator" misc_recomb 6504..6537 /label=loxP recognition sequence for Cre recombinase /note="loxP recognition sequence for Cre recombinase" protein_bind complement(6504..6537) /label=loxP /bound_moiety="Cre recombinase" /note="Cre-mediated recombination occurs in the 8-bp core sequence (GCATACAT)."
This page is informational only.