Basic Vector Information
- Vector Name:
- pEKH-sigI6
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8923 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Sand A, Holwerda EK, Ruppertsberger NM, Maloney M, Olson DG, Nataf Y, Borovok I, Sonenshein AL, Bayer EA, Lamed R, Lynd LR, Shoham Y.
pEKH-sigI6 vector Map
pEKH-sigI6 vector Sequence
LOCUS V007584 8923 bp DNA circular SYN 17-DEC-2018 DEFINITION Exported. ACCESSION V007584 VERSION V007584 KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct . REFERENCE 1 (bases 1 to 8923) AUTHORS Sand A, Holwerda EK, Ruppertsberger NM, Maloney M, Olson DG, Nataf Y, Borovok I, Sonenshein AL, Bayer EA, Lamed R, Lynd LR, Shoham Y. TITLE Three cellulosomal xylanase genes in Clostridium thermocellum are regulated by both vegetative SigA (sigma(A)) and alternative SigI6 (sigma(I6)) factors JOURNAL FEBS Lett. 589 (20), 3133-3140 (2015) PUBMED 26320414 REFERENCE 2 (bases 1 to 8923) AUTHORS Holwerda EK. TITLE Direct Submission JOURNAL Submitted (24-JUL-2015) Thayer School of Engineering, Dartmouth College, 14 Engineering drive, Hanover, NH 03755, USA REFERENCE 3 (bases 1 to 8923) TITLE Direct Submission REFERENCE 4 (bases 1 to 8923) AUTHORS . TITLE Direct Submission COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## SGRef: number: 1; type: "Journal Article"; journalName: "FEBS Lett."; date: "2015"; volume: "589"; issue: "20"; pages: "3133-3140" SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (24-JUL-2015) Thayer School of Engineering, Dartmouth College, 14 Engineering drive, Hanover, NH 03755, USA" SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8923 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(561..1418) /label="AmpR" /note="beta-lactamase" promoter complement(1419..1523) /label="AmpR promoter" CDS 3510..4157 /gene="cat" /label="Chloramphenicol acetyltransferase" /note="Chloramphenicol acetyltransferase from Staphylococcus aureus. Accession#: P00485" CDS 4178..4723 /codon_start=1 /product="hypoxanthine phosphoribosyltransferase" /EC_number="2.4.2.8" /label="hypoxanthine phosphoribosyltransferase" /protein_id="ALI61576.1" /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD EKYRNLPFIGVLKPEMYS" terminator 5521..5709 /label="CYC1 terminator" /note="transcription terminator for CYC1" rep_origin complement(5969..6557) /direction=LEFT /label="ori" /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(6644..7222) /codon_start=1 /product="thymidine kinase" /EC_number="2.7.1.21" /label="thymidine kinase" /protein_id="ALI61575.1" /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP ANYDDPIIMVGAKESYEARCRKCHEVPRT" CDS complement(7922..8923) /label="repB" /note="RepB replication protein"
This page is informational only.