Basic Vector Information
- Vector Name:
- pEKEx2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8161 bp
- Type:
- Shuttle-expression vector
- Replication origin:
- ori
- Source/Author:
- Krumbach K, Eggeling L, Eikmanns B.
pEKEx2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEKEx2 vector Sequence
LOCUS 40924_17299 8161 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle-expression vector pEKEx2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8161) AUTHORS Krumbach K, Eggeling L, Eikmanns B. TITLE Direct Submission JOURNAL Submitted (30-MAR-2004) Biotechnology, Forschungszentrum, Leo-Brand, Juelich, NRW 52425, Germany REFERENCE 2 (bases 1 to 8161) TITLE Direct Submission REFERENCE 3 (bases 1 to 8161) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (30-MAR-2004) Biotechnology, Forschungszentrum, Leo-Brand, Juelich, NRW 52425, Germany" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..8161 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1..57) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(58..74) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" terminator 287..373 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 465..492 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" promoter 511..602 /label=AmpR promoter primer_bind complement(923..939) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(947..963) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(971..1001) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(1016..1037) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(1325..1913) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 2146..2958 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" CDS 4577..5860 /codon_start=1 /product="replicase" /label=replicase /note="orf-1 from Corynebacterium glutamicum pBL1" /protein_id="AAS99552.1" /translation="MNTSKEPQVNEGSKVTRARAWRRQNVMYKITNSKALAGCHRWRRD EAVAVSWSSNGASQFEGLQNSHSRWGSPLAELEVMGERRIELAIATKNHLAAGGALMMF VGTVRHNRSQSFAQVEAGIKTAYSSMVKTSQWKKERARYGVEHTYSDYEVTDSWANGWH LHRNMLLFLDRPLSDDELKAFEDSMFSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDA AKMATYLAKGMSQELTGSATKTASKGSYTPFQMLDMLADQSDAGEDMDAVLVARWREYE VGSKNLRSSWSRGAKRALGIDYIDADVRREMEEELYKLAGLEAPERVESTRVAVALVKP DDWKLIQSDFAVRQYVLDCVDKAKDVAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAV LPTHGDATKRDLNAAVFAGNEQTILRTH" promoter complement(6581..6609) /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS complement(6724..7752) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ASA" promoter complement(7753..7830) /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." promoter 8064..8092 /label=tac promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 8100..8116 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.