Basic Vector Information
- Vector Name:
- pEGFP-LC3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5095 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CMV
pEGFP-LC3 vector Vector Map
pEGFP-LC3 vector Sequence
LOCUS 40924_17174 5095 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pEGFP-LC3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5095) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 5095) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 5095) TITLE Direct Submission REFERENCE 4 (bases 1 to 5095) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5095 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 613..1329 /label=EGFP /note="enhanced GFP" CDS 1345..1722 /codon_start=1 /note="unnamed protein product; LC3" /protein_id="SJL86687.1" /translation="MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLP VLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERD EDGFLYMVYASQETFGTALAV" polyA_signal 1883..2004 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2011..2466) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2493..2597 /label=AmpR promoter promoter 2599..2956 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2991..3782 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" polyA_signal 4017..4064 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4393..4981 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.