Basic Vector Information
- Vector Name:
- pEGFP-C1-M
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5118 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Zhang X, Wang XY, Jia YL, Guo X, Wang YF, Wang TY.
- Promoter:
- CMV
pEGFP-C1-M vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pEGFP-C1-M vector Sequence
LOCUS 40924_17144 5118 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pEGFP-C1-M, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 5118) AUTHORS Zhang X, Wang XY, Jia YL, Guo X, Wang YF, Wang TY. TITLE A Vector Based on the Chicken Hypersensitive Site 4 Insulator Element Replicates Episomally in Mammalian Cell JOURNAL Curr Gene Ther (2017) In press PUBMED 28155604 REFERENCE 2 (bases 1 to 5118) AUTHORS Wang T. TITLE Direct Submission JOURNAL Submitted (22-JAN-2017) Department of Biochemistry and Molecular Biology, Xinxiang Medical University, Jinsui Road, Xinxiang, Henan 453000, Xinxiang REFERENCE 3 (bases 1 to 5118) TITLE Direct Submission REFERENCE 4 (bases 1 to 5118) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr Gene Ther (2017) In press" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2017) Department of Biochemistry and Molecular Biology, Xinxiang Medical University, Jinsui Road, Xinxiang, Henan 453000, Xinxiang" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..5118 /mol_type="other DNA" /organism="synthetic DNA construct" enhancer 61..364 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" promoter 365..568 /label=CMV promoter /note="human cytomegalovirus (CMV) immediate early promoter" CDS 613..1329 /codon_start=1 /label=EGFP /note="enhanced GFP" /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL EFVTAAGITLGMDELYK" misc_feature 1717..1782 /label=MCS /note="multiple cloning site" polyA_signal 1906..2027 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(2034..2489) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2516..2620 /label=AmpR promoter promoter 2622..2979 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 3014..3805 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 4040..4087 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 4416..5004 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.