Basic Vector Information
- Vector Name:
- pEF6htBIDMycHis
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6161 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- EF-1α
pEF6htBIDMycHis vector Vector Map
pEF6htBIDMycHis vector Sequence
LOCUS 40924_17079 6161 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pEF6htBIDMycHis, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6161) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6161) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6161) TITLE Direct Submission REFERENCE 4 (bases 1 to 6161) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6161 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 351..1529 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" promoter 1546..1564 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" CDS 1620..2027 /codon_start=1 /note="unnamed protein product; htBID" /protein_id="SJL87229.1" /translation="MGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPG LVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHT PSLLRDVFHTTVNFINQNLRTYVRSLARNGMD" CDS 2043..2072 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" CDS 2088..2105 /label=6xHis /note="6xHis affinity tag" polyA_signal 2134..2358 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 2404..2832 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 2846..3175 /label=SV40 promoter /note="SV40 enhancer and early promoter" promoter 3223..3270 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 3289..3684 /label=BSD /note="blasticidin S deaminase" polyA_signal 3845..3978 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(4015..4031) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4039..4055) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4063..4093) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4108..4129) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4406..4994) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5168..6025) /label=AmpR /note="beta-lactamase" promoter complement(6026..6130) /label=AmpR promoter
This page is informational only.