Price Information
Cat No. | Plasmid Name | Availability | Add to cart |
---|---|---|---|
V012083 | pEP4 E02S EN2L | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pEP4 E02S EN2L
- Antibiotic Resistance:
- Ampicillin
- Length:
- 15415 bp
- Type:
- Episomal/EBNA
- Replication origin:
- ori
- Copy Number:
- Low Copy
- Promoter:
- EF-1α
- Cloning Method:
- Restriction Enzyme
- 5' Primer:
- na
pEP4 E02S EN2L vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pEP4 E02S EN2L vector Sequence
LOCUS 40924_17572 15415 bp DNA circular SYN 13-MAY-2021 DEFINITION used in the derivation of human iPS cells using non-integrating episomal vectors; expresses Oct4 and Sox2; Nanog and Lin28. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 15415) AUTHORS Yu J, Hu K, Smuga-Otto K, Tian S, Stewart R, Slukvin II, Thomson JA TITLE Human Induced Pluripotent Stem Cells Free of Vector and Transgene Sequences JOURNAL Science. 2009 Mar 26. PUBMED 19325077 REFERENCE 2 (bases 1 to 15415) TITLE Direct Submission REFERENCE 3 (bases 1 to 15415) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Science. 2009 Mar 26." COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..15415 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 32..243 /label=EF-1-alpha core promoter /note="core promoter for human elongation factor EF-1-alpha" intron 244..1166 /label=EF-1-alpha intron A /note="intron upstream of the start codon of human EF-1-alpha" CDS 1229..2308 /codon_start=1 /label=hOct4 /note="Homo sapiens Oct-4 gene. Encodes a transcription factor containing a POU homeodomain that plays a key role in embryonic development and stem cell pluripotency. Aberrant expression in adult tissues is associated with tumorigenesis." /translation="MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGP GIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAXVGVE SNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYT QADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICK AETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNR RQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFP EGEAFPPVSVTTLGSPMHSN" misc_feature 2385..2958 /label=IRES /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 2991..3941 /codon_start=1 /label=hSOX2 /note="Homo sapiens transcription factor SOX-2 gene. Belongs to the SRY-related HMG-box (SOX) family of transcription factors, which is involved in the regulation of embryonic development and in the determination of cell fate" /translation="MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPM NAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKE HPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHM NGWSNGSYSMMQDQLGYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPT YSMSYSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGA EVPEPAAPSRLHMSQHYQSGPVPGTAINGTLPLSHM" polyA_signal complement(3977..4111) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" promoter 4641..5803 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" CDS 5872..6786 /codon_start=1 /label=hNanog /note="Homo sapiens nanog homeobox gene. Encodes a DNA-binding homeobox-family transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency." /translation="MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEM PHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSS TQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSN GVTQKASAPTYPSLYSSYHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWN TQTWCTQSWNNQAWNSPFYNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTT RYFSTPQTMDLFLNYSMNMQPEDV" misc_feature 6847..7430 /label=IRES2 /note="internal ribosome entry site (IRES) of the encephalomyocarditis virus (EMCV)" CDS 7457..8083 /codon_start=1 /label=hLIN28A /note="Human lin-28 homolog A gene. Encodes a LIN-28 family RNA-binding protein that acts as a posttranscriptional regulator of genes involved in development, self-renewal of embryonic stem cells and metabolism. Overexpressed in human embryonic stem cells, primary human tumors and human cancer cell lines." /translation="MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICK WFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGL ESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHF CQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN" polyA_signal complement(8116..8250) /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(8981..10770) /direction=LEFT /label=oriP /note="Epstein-Barr virus oriP replication origin (Yates et al., 2000)" CDS complement(11075..12997) /codon_start=1 /label=EBNA1 /note="Epstein-Barr nuclear antigen 1, also known as EBNA-1" /translation="MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRGR GRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGGAG AGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAGGGA GGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGAGAGG GAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGGAGAG GGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGSGGRGRG GSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSGSPPRRPP PGRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGPRGQGDGGR RKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVFVYGGSKTSL YNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFLQTHIFAEVLK DAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDGDDGDEGGDGDE GEEGQE" primer_bind complement(13436..13454) /label=pBRforEco /note="pBR322 vectors, upsteam of EcoRI site, forward primer" promoter 13522..13626 /label=AmpR promoter CDS 13627..14484 /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" rep_origin 14658..15246 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"