Basic Vector Information
- Vector Name:
- pEF6A-E-PKR-ND
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6582 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- EF-1α
pEF6A-E-PKR-ND vector Vector Map
pEF6A-E-PKR-ND vector Sequence
LOCUS 40924_17059 6582 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pEF6A-E-PKR-ND, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6582) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6582) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6582) TITLE Direct Submission REFERENCE 4 (bases 1 to 6582) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6582 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 351..1529 /label=EF-1-alpha promoter /note="strong constitutive promoter for human elongation factor EF-1-alpha" promoter 1546..1564 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature 1639..1677 /label=E-tag /note="E-tag" CDS 1687..2442 /codon_start=1 /note="unnamed protein product; hPKR-ND" /protein_id="SJL86758.1" /translation="MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQV IIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGL INRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYL QILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSL NSSSLLMNGLRNNQRKAKRSLAPRFDLPD" CDS 2464..2493 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" CDS 2509..2526 /label=6xHis /note="6xHis affinity tag" polyA_signal 2555..2779 /label=bGH poly(A) signal /note="bovine growth hormone polyadenylation signal" rep_origin 2825..3253 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 3267..3596 /label=SV40 promoter /note="SV40 enhancer and early promoter" promoter 3644..3691 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 3710..4105 /label=BSD /note="blasticidin S deaminase" polyA_signal 4266..4399 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" primer_bind complement(4436..4452) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4460..4476) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4484..4514) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4529..4550) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4827..5415) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5589..6446) /label=AmpR /note="beta-lactamase" promoter complement(6447..6551) /label=AmpR promoter
This page is informational only.