Basic Vector Information
- Vector Name:
- pEC-XT99A
- Length:
- 7509 bp
- Type:
- Shuttle expression vector
- Replication origin:
- ori
- Source/Author:
- Kirchner O, Tauch A.
pEC-XT99A vector Map
pEC-XT99A vector Sequence
LOCUS 40924_16695 7509 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle expression vector pEC-XT99A, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7509) AUTHORS Kirchner O, Tauch A. TITLE Tools for genetic engineering in the amino acid-producing bacterium Corynebacterium glutamicum JOURNAL J. Biotechnol. 104 (1-3), 287-299 (2003) PUBMED 12948646 REFERENCE 2 (bases 1 to 7509) AUTHORS Kirchner O, Tauch A. TITLE Direct Submission JOURNAL Submitted (15-JAN-2003) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany REFERENCE 3 (bases 1 to 7509) TITLE Direct Submission REFERENCE 4 (bases 1 to 7509) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biotechnol. 104 (1-3), 287-299 (2003)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-JAN-2003) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7509 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 1..57 /label=MCS /note="pUC18/19 multiple cloning site" terminator 260..346 /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" terminator 438..465 /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" CDS 769..2232 /codon_start=1 /gene="repA" /product="RepA" /label=repA /note="replication protein" /protein_id="AAO65199.1" /translation="MTLADPQDTVTASAWKLSADLFDTHPEAMRCGSRGWTAEDRRELL AHLGRESFQGSKTRDFASAWIKNPDTGETQPKLYRAGSKALTRCQYVALTHAQHAAVIV LDIDVPSHQAGGKIEHVNPQVYAILEKWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAA AGKTSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYKWHCQHDRVDRLA DLMEIARTMTGSQKPKKYIEQDFSSGRARIEAAQRATAEAKALAILDASLPSALDASGD LIDGVRVLWTNPERARDETAFRHALTVGYQLKAAGERLKDAKIIDAYEVAYNVAQAVGA DGREPDLPAMRDRLTMARRVRGYVAKGQPVVPARRVETQSSRGRKALATMGRRGAATSN ARRWADPESKYAQETRQRLAEANKRREMTGELLELRVKTAILDARSQSVADPSTRELAG ELGVSERRIQQVRKALGMEAKRGRPRAEN" gene 769..2232 /gene="repA" /label=repA CDS 2875..3090 /codon_start=1 /gene="per" /product="Per" /label=per /note="positive effector of replication" /protein_id="AAO65200.1" /translation="MDLSDVALESDALDAAVDLKTVIGFFRALDTTDAPASRDWASAAS DLETLVADLEELADELRARQRQEDAQ" gene 2875..3090 /gene="per" /label=per CDS complement(3651..3662) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" rep_origin 4941..5529 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(5715..5855) /label=bom /note="basis of mobility region from pBR322" promoter 6041..6118 /label=lacIq promoter /note="In the lacIq allele, a single base change in the promoter boosts expression of the lacI gene about 10-fold." CDS 6119..7198 /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter 7433..7462 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 7470..7486 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.