Basic Vector Information
- Vector Name:
- pEC-T19mob2
- Length:
- 6213 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Kirchner O, Tauch A.
pEC-T19mob2 vector Vector Map
pEC-T19mob2 vector Sequence
LOCUS 40924_16680 6213 bp DNA circular SYN 17-DEC-2018 DEFINITION Shuttle vector pEC-T19mob2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6213) AUTHORS Kirchner O, Tauch A. TITLE Tools for genetic engineering in the amino acid-producing bacterium Corynebacterium glutamicum JOURNAL J. Biotechnol. 104 (1-3), 287-299 (2003) PUBMED 12948646 REFERENCE 2 (bases 1 to 6213) AUTHORS Kirchner O, Tauch A. TITLE Direct Submission JOURNAL Submitted (22-JAN-2003) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany REFERENCE 3 (bases 1 to 6213) TITLE Direct Submission REFERENCE 4 (bases 1 to 6213) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Biotechnol. 104 (1-3), 287-299 (2003)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (22-JAN-2003) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6213 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1..57) /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(58..74) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 400..1863 /codon_start=1 /gene="repA" /product="RepA" /label=repA /note="replication protein" /protein_id="AAO66613.1" /translation="MTLADPQDTVTASAWKLSADLFDTHPEAMRCGSRGWTAEDRRELL AHLGRESFQGSKTRDFASAWIKNPDTGETQPKLYRAGSKALTRCQYVALTHAQHAAVIV LDIDVPSHQAGGKIEHVNPQVYAILEKWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAA AGKTSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYKWHCQHDRVDRLA DLMEIARTMTGSQKPKKYIEQDFSSGRARIEAAQRATAEAKALAILDASLPSALDASGD LIDGVRVLWTNPERARDETAFRHALTVGYQLKAAGERLKDAKIIDAYEVAYNVAQAVGA DGREPDLPAMRDRLTMARRVRGYVAKGQPVVPARRVETQSSRGRKALATMGRRGAATSN ARRWADPESKYAQETRQRLAEANKRREMTGELLELRVKTAILDARSQSVADPSTRELAG ELGVSERRIQQVRKALGMEAKRGRPRAEN" gene 400..1863 /gene="repA" /label=repA CDS 2506..2721 /codon_start=1 /gene="per" /product="Per" /label=per /note="positive effector of replication" /protein_id="AAO66614.1" /translation="MDLSDVALESDALDAAVDLKTVIGFFRALDTTDAPASRDWASAAS DLETLVADLEELADELRARQRQEDAQ" gene 2506..2721 /gene="per" /label=per CDS complement(3677..3688) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" oriT complement(4892..4999) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 5211..5799 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 6087..6108 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 6123..6153 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 6161..6177 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 6185..6201 /label=M13 rev /note="common sequencing primer, one of multiple similar variants"
This page is informational only.