Basic Vector Information
- Vector Name:
- pEC-T18mob2
- Length:
- 6209 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Tauch A, Kirchner O, Loffler B, Gotker S, Puhler A, Kalinowski J.
pEC-T18mob2 vector Map
pEC-T18mob2 vector Sequence
LOCUS 40924_16675 6209 bp DNA circular SYN 17-DEC-2018 DEFINITION Cloning vector pEC-T18mob2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6209) AUTHORS Tauch A, Kirchner O, Loffler B, Gotker S, Puhler A, Kalinowski J. TITLE Efficient electrotransformation of corynebacterium diphtheriae with a mini-replicon derived from the Corynebacterium glutamicum plasmid pGA1 JOURNAL Curr. Microbiol. 45 (5), 362-367 (2002) PUBMED 12232668 REFERENCE 2 (bases 1 to 6209) AUTHORS Tauch A. TITLE Direct Submission JOURNAL Submitted (08-NOV-2001) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany REFERENCE 3 (bases 1 to 6209) TITLE Direct Submission REFERENCE 4 (bases 1 to 6209) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Curr. Microbiol."; date: "2002"; volume: "45"; issue: "5"; pages: "362-367" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (08-NOV-2001) Department of Genetics, University of Bielefeld, Universitaetsstrasse 25, Bielefeld D-33615, Germany" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6209 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 184..1647 /codon_start=1 /gene="rep" /product="replication protein" /label=rep /note="Rep" /protein_id="AAL38583.1" /translation="MTLADPQDTVTASAWKLSADLFDTHPEAMRCGSRGWTAEDRRELL AHLGRESFQGSKTRDFASAWIKNPDTGETQPKLYRAGSKALTRCQYVALTHAQHAAVIV LDIDVPSHQAGGKIEHVNPQVYAILEKWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAA AGKTSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYKWHCQHDRVDRLA DLMEIARTMTGSQKPKKYIEQDFSSGRARIEAAQRATAEAKALAILDASLPSALDASGD LIDGVRVLWTNPERARDETAFRHALTVGYQLKAAGERLKDAKIIDAYEVAYNVAQAVGA DGREPDLPAMRDRLTMARRVRGYVAKGQPVVPARRVETQSSRGRKALATMGRRGAATSN ARRWADPESKYAQETRQRLAEANKRREMTGELLELRVKTAILDARSQSVADPSTRELAG ELGVSERRIQQVRKALGMEAKRGRPRAEN" gene 184..1647 /gene="rep" /label=rep CDS 2290..2505 /codon_start=1 /gene="per" /product="positive effector of replication" /label=per /note="Per" /protein_id="AAL38584.1" /translation="MDLSDVALESDALDAAVDLKTVIGFFRALDTTDAPASRDWASAAS DLETLVADLEELADELRARQRQEDAQ" gene 2290..2505 /gene="per" /label=per CDS complement(3457..3468) /codon_start=1 /label=Factor Xa site /note="Factor Xa recognition and cleavage site" /translation="IEGR" oriT complement(4672..4779) /direction=LEFT /label=oriT /note="incP origin of transfer" rep_origin 4991..5579 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 5867..5888 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 5903..5933 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 5941..5957 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 5965..5981 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" misc_feature 5991..6047 /label=MCS /note="pUC18/19 multiple cloning site" primer_bind complement(6051..6067) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants"
This page is informational only.